PDB entry 5z9y

View 5z9y on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis thiazole synthase (ThiG) complexed with DXP
Class: transferase
Keywords: alpha-beta barrel, covalently bound, carbinolamine intermediate, BIOSYNTHETIC PROTEIN, TRANSFERASE
Deposited on 2018-02-05, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiazole synthase
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: thiG, Rv0417, MTCY22G10.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z9ya_
  • Chain 'B':
    Compound: Thiazole synthase
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: thiG, Rv0417, MTCY22G10.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z9yb_
  • Heterogens: DXP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z9yA (A:)
    vaesklvigdrsfasrlimgtggatnlavleqaliasgtelttvairrvdadggtglldl
    lnrlgitplpntagsrsaaeavltaqlarealntnwvkleviadertlwpdavelvraae
    qlvddgfvvlpyttddpvlarrledtgcaavmplgspigtglgianphniemivagarvp
    vvldagigtasdaalamelgcdavllasavtraadppamaaamaaavtagylarcagrip
    krfwaqasspar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z9yA (A:)
    klvigdrsfasrlimgtggatnlavleqaliasgtelttvaiglldllnrlgitplpnta
    gsrsaaeavltaqlarealntnwvkleviadertlwpdavelvraaeqlvddgfvvlpyt
    tddpvlarrledtgcaavmplgspigtglgianphniemivagarvpvvldagigtasda
    alamelgcdavllasavtraadppamaaamaaavtagylarcagripkrfwa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z9yB (B:)
    vaesklvigdrsfasrlimgtggatnlavleqaliasgtelttvairrvdadggtglldl
    lnrlgitplpntagsrsaaeavltaqlarealntnwvkleviadertlwpdavelvraae
    qlvddgfvvlpyttddpvlarrledtgcaavmplgspigtglgianphniemivagarvp
    vvldagigtasdaalamelgcdavllasavtraadppamaaamaaavtagylarcagrip
    krfwaqasspar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z9yB (B:)
    klvigdrsfasrlimgtggatnlavleqaliasgtelttvaiglldllnrlgitplpnta
    gsrsaaeavltaqlarealntnwvkleviadertlwpdavelvraaeqlvddgfvvlpyt
    tddpvlarrledtgcaavmplgspigtglgianphniemivagarvpvvldagigtasda
    alamelgcdavllasavtraadppamaaamaaavtagylarcagripkrfwaqa