PDB entry 5z9b

View 5z9b on RCSB PDB site
Description: Bacterial GyrB ATPase domain in complex with (3,4-dichlorophenyl)hydrazine
Class: isomerase
Keywords: DNA Topoisomerase, Antibacterial, Drug Target, Fragment-base Lead Discovery, ISOMERASE
Deposited on 2018-02-02, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: gyrB, acrB, cou, himB, hisU, nalC, parA, pcbA, b3699, JW5625
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z9ba_
  • Chain 'B':
    Compound: DNA gyrase subunit b
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: gyrB, acrB, cou, himB, hisU, nalC, parA, pcbA, b3699, JW5625
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z9bb_
  • Heterogens: HX3, PO4, AX7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z9bA (A:)
    gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
    grgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnalsqklelvi
    qregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrel
    sflnsgvsirlrdkrdgkedhfhyegg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z9bA (A:)
    ldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqddg
    rgiptgihpeegvsaaevimtvlhgvgvsvvnalsqklelviqregkihrqiyehgvpqa
    plavtgetektgtmvrfwpsletftnvtefeyeilakrlrelsflnsgvsirlrdkrdgk
    edhfhy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z9bB (B:)
    gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
    grgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnalsqklelvi
    qregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrel
    sflnsgvsirlrdkrdgkedhfhyegg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z9bB (B:)
    ldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqddg
    rgiptgihpeegvsaaevimtvlgvgvsvvnalsqklelviqregkihrqiyehgvpqap
    lavtgetektgtmvrfwpsletftnvtefeyeilakrlrelsflnsgvsirlrdkrdgke
    dhfhyeg