PDB entry 5z95

View 5z95 on RCSB PDB site
Description: Structural basis for specific inhibition of highly sensitive ShHTL7 receptor
Class: hydrolase
Keywords: Strigolactone receptor, Hydrolase, Striga germination signaling
Deposited on 2018-02-02, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hyposensitive to light 7
    Species: Striga hermonthica [TaxId:68872]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z95a_
  • Heterogens: EGC, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z95A (A:)
    gplgsmssiglahnvtilgsgettvvlghgygtdqsvwkllvpylvddykvllydhmgag
    ttnpdyfdfdrysslegysydliaileefqvskciyvghsmssmaaavasifrpdlfhkl
    vmisptprlinteeyyggfeqkvmdetlrsldenfkslslgtaplllacdlesaamqeyc
    rtlfnmrpdiaccitrmicgldlrpylghvtvpchiiqssndimvpvavgeylrknlggp
    svvevmpteghlphlsmpevtipvvlrhirqditdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z95A (A:)
    siglahnvtilgsgettvvlghgygtdqsvwkllvpylvddykvllydhmgagttnpdyf
    dfdrysslegysydliaileefqvskciyvghsmssmaaavasifrpdlfhklvmisptp
    rlinteeyyggfeqkvmdetlrsldenfkslslgtaplllacdlesaamqeycrtlfnmr
    pdiaccitrmicgldlrpylghvtvpchiiqssndimvpvavgeylrknlggpsvvevmp
    teghlphlsmpevtipvvlrhirqditd