PDB entry 5z84

View 5z84 on RCSB PDB site
Description: The structure of azide-bound cytochrome c oxidase determined using the crystals exposed to 20 mM azide solution for 4 days
Class: oxidoreductase
Keywords: metalloenzyme cytochrome c oxidase proton pump bioenergetics heme copper, OXIDOREDUCTASE
Deposited on 2018-01-31, released 2018-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84a_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84b1, d5z84b2
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84c_
  • Chain 'D':
    Compound: cytochrome c oxidase subunit 4 isoform 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84d_
  • Chain 'E':
    Compound: cytochrome c oxidase subunit 5a, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84e_
  • Chain 'F':
    Compound: cytochrome c oxidase subunit 5b, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84f_
  • Chain 'G':
    Compound: Cytochrome c oxidase subunit 6A2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84g_
  • Chain 'H':
    Compound: Cytochrome c oxidase subunit 6B1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84h_
  • Chain 'I':
    Compound: Cytochrome c oxidase subunit 6C
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84i_
  • Chain 'J':
    Compound: cytochrome c oxidase subunit 7a1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84j_
  • Chain 'K':
    Compound: cytochrome c oxidase subunit 11, Cytochrome c oxidase subunit 7B, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84k_
  • Chain 'L':
    Compound: cytochrome c oxidase subunit 7c, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84l_
  • Chain 'M':
    Compound: cytochrome c oxidase subunit 8b, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84m_
  • Chain 'N':
    Compound: Cytochrome c oxidase subunit 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84n_
  • Chain 'O':
    Compound: Cytochrome c oxidase subunit 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84o1, d5z84o2
  • Chain 'P':
    Compound: Cytochrome c oxidase subunit 3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84p_
  • Chain 'Q':
    Compound: cytochrome c oxidase subunit 4 isoform 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84q_
  • Chain 'R':
    Compound: cytochrome c oxidase subunit 5a, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84r_
  • Chain 'S':
    Compound: cytochrome c oxidase subunit 5b, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84s_
  • Chain 'T':
    Compound: Cytochrome c oxidase subunit 6A2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84t_
  • Chain 'U':
    Compound: Cytochrome c oxidase subunit 6B1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84u_
  • Chain 'V':
    Compound: Cytochrome c oxidase subunit 6C
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84v_
  • Chain 'W':
    Compound: cytochrome c oxidase subunit 7a1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84w_
  • Chain 'X':
    Compound: cytochrome c oxidase subunit 11, Cytochrome c oxidase subunit 7B, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84x_
  • Chain 'Y':
    Compound: cytochrome c oxidase subunit 7c, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84y_
  • Chain 'Z':
    Compound: cytochrome c oxidase subunit 8b, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5z84z_
  • Heterogens: HEA, CU, MG, NA, AZI, TGL, PGV, EDO, CHD, CUA, PSC, DMU, UNX, PEK, CDL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5z84A (A:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5z84B (B:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5z84C (C:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84C (C:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5z84D (D:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84D (D:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5z84E (E:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84E (E:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5z84F (F:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5z84G (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84G (G:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5z84H (H:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84H (H:)
    kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
    swvstwddrraegtfpgki
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5z84I (I:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5z84J (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84J (J:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5z84K (K:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84K (K:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5z84L (L:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84L (L:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5z84M (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84M (M:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5z84N (N:)
    mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
    hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
    gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
    tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
    pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
    trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
    ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
    vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
    evltvdltttnlewlngcpppyhtfeeptyvnlk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5z84O (O:)
    maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
    vetiwtilpaiililialpslrilymmdeinnpsltvktmghqwywsyeytdyedlsfds
    ymiptselkpgelrllevdnrvvlpmemtirmlvssedvlhswavpslglktdaipgrln
    qttlmssrpglyygqcseicgsnhsfmpivlelvplkyfekwsasml
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5z84P (P:)
    mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
    virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
    ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
    yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaaw
    ywhfvdvvwlflyvsiywwgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84P (P:)
    hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
    restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
    plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
    eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
    hfvdvvwlflyvsiywwgs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5z84Q (Q:)
    ahgsvvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvely
    rlkfkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqt
    krmldmkvapiqgfsakwdydknewkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84Q (Q:)
    svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
    fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
    ldmkvapiqgfsakwdydknewkk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5z84R (R:)
    shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
    fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84R (R:)
    hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
    vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5z84S (S:)
    asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
    iceednstviwfwlhkgeaqrcpscgthyklvphqlah
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5z84T (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84T (T:)
    asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
    swgdgnhtffhnprvnplptgyek
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5z84U (U:)
    aediqakiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvy
    kslcpiswvstwddrraegtfpgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84U (U:)
    kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
    swvstwddrraegtfpgki
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5z84V (V:)
    stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
    eemrkagifqsak
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5z84W (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84W (W:)
    fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5z84X (X:)
    ihqkrapdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewreq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84X (X:)
    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >5z84Y (Y:)
    shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84Y (Y:)
    hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >5z84Z (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykkssaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z84Z (Z:)
    itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks