PDB entry 5z7z

View 5z7z on RCSB PDB site
Description: Crystal structure of Striga hermonthica Dwarf14 (ShD14)
Class: hydrolase
Keywords: Hydrolase Activity, putative receptor of strigolactone, HYDROLASE
Deposited on 2018-01-30, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dwarf 14
    Species: Striga hermonthica [TaxId:68872]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M5I7R9 (9-End)
      • expression tag (8)
      • see sequence details (207)
    Domains in SCOPe 2.07: d5z7za1, d5z7za2
  • Chain 'B':
    Compound: Dwarf 14
    Species: Striga hermonthica [TaxId:68872]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M5I7R9 (9-End)
      • expression tag (5-8)
      • see sequence details (207)
    Domains in SCOPe 2.07: d5z7zb1, d5z7zb2
  • Heterogens: PEG, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z7zA (A:)
    gpgyqdpnssllealnvrvvgsgekvlvlahgvgtdqsawqrilpyfvrdhrvvlydlvc
    agsvnpdyfdfrrytsldafvddllaildalrlgrctyvghsvsasigilasirrpdlfa
    kliligasprflndknyhggfadgeidtvfaameanyaawvsgfaplavgadvpeavref
    srtlfnmrpditlfvsrmvfnsdlrgvlglvtvpcsvlqtskdhsvpesmaaylkenlgg
    rttvhmldieghlphlsapnllaqelrralpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z7zA (A:)
    ssllealnvrvvgsgekvlvlahgvgtdqsawqrilpyfvrdhrvvlydlvcagsvnpdy
    fdfrrytsldafvddllaildalrlgrctyvghsvsasigilasirrpdlfakliligas
    prflndknyhggfadgeidtvfaameanyaawvsgfaplavgadvpeavrefsrtlfnmr
    pditlfvsrmvfnsdlrgvlglvtvpcsvlqtskdhsvpesmaaylkenlggrttvhmld
    ieghlphlsapnllaqelrralp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z7zB (B:)
    gpgyqdpnssllealnvrvvgsgekvlvlahgvgtdqsawqrilpyfvrdhrvvlydlvc
    agsvnpdyfdfrrytsldafvddllaildalrlgrctyvghsvsasigilasirrpdlfa
    kliligasprflndknyhggfadgeidtvfaameanyaawvsgfaplavgadvpeavref
    srtlfnmrpditlfvsrmvfnsdlrgvlglvtvpcsvlqtskdhsvpesmaaylkenlgg
    rttvhmldieghlphlsapnllaqelrralpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z7zB (B:)
    dpnssllealnvrvvgsgekvlvlahgvgtdqsawqrilpyfvrdhrvvlydlvcagsvn
    pdyfdfrrytsldafvddllaildalrlgrctyvghsvsasigilasirrpdlfaklili
    gasprflndknyhggfadgeidtvfaameanyaawvsgfaplavgadvpeavrefsrtlf
    nmrpditlfvsrmvfnsdlrgvlglvtvpcsvlqtskdhsvpesmaaylkenlggrttvh
    mldieghlphlsapnllaqelrralp