PDB entry 5z7x

View 5z7x on RCSB PDB site
Description: Crystal structure of Striga hermonthica HTL4 (ShHTL4)
Class: hydrolase
Keywords: Hydrolase Activity, putative receptor of strigolactone, HYDROLASE
Deposited on 2018-01-30, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hyposensitive to light 4
    Species: Striga hermonthica [TaxId:68872]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z7xa1, d5z7xa2
  • Heterogens: EDO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z7xA (A:)
    gplgsmstvgsahnvrvlgsgettvvlghgfgtdqsvwkqlvpyltdeyrvllydnmgag
    ttnpdcydferyssleghsndliailddfhvtkciyvghslssmaaavssifrpdlfrkv
    vmisatpritntedyyggfeqeeinqmntameenfktmmmgfapivvggdlesdaiqefs
    rtlfnmrpdialsicrmisgldlrpylglivvpchiiqsskdmlvpvavaeylhknlggk
    svvelipteghlphlsapeltipvlvrhikhdia
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z7xA (A:)
    smstvgsahnvrvlgsgettvvlghgfgtdqsvwkqlvpyltdeyrvllydnmgagttnp
    dcydferyssleghsndliailddfhvtkciyvghslssmaaavssifrpdlfrkvvmis
    atpritntedyyggfeqeeinqmntameenfktmmmgfapivvggdlesdaiqefsrtlf
    nmrpdialsicrmisgldlrpylglivvpchiiqsskdmlvpvavaeylhknlggksvve
    lipteghlphlsapeltipvlvrhikhdia