PDB entry 5z7w

View 5z7w on RCSB PDB site
Description: Crystal structure of Striga hermonthica HTL1 (ShHTL1)
Class: hydrolase
Keywords: Hydrolase Activity, putative receptor of karrikin, HYDROLASE
Deposited on 2018-01-30, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hyposensitive to light 1
    Species: Striga hermonthica [TaxId:68872]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z7wa_
  • Chain 'B':
    Compound: Hyposensitive to light 1
    Species: Striga hermonthica [TaxId:68872]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z7wb1, d5z7wb2
  • Heterogens: MG, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z7wA (A:)
    gplgsmglaqeahnvrvlgsgpqtvvlahgfgtdqsvwkylvphlvedyrvvlfdimgag
    ttnptyfnferysslegyagdviaileelqisscvyvghsvsamigviasvtrpdlftkl
    vtvagsprylndpdyfggfdldelhelfeamkenykawcsgfaplcvgadmeslavqefs
    rtlfnmrpdialsilqtifysdvrpllphvtvpchiiqsvkdlavpvavseyihqslgge
    silevmateghlpqlsspdvvvpvllrhiryaiarpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z7wA (A:)
    glaqeahnvrvlgsgpqtvvlahgfgtdqsvwkylvphlvedyrvvlfdimgagttnpty
    fnferysslegyagdviaileelqisscvyvghsvsamigviasvtrpdlftklvtvags
    prylndpdyfggfdldelhelfeamkenykawcsgfaplcvgadmeslavqefsrtlfnm
    rpdialsilqtifysdvrpllphvtvpchiiqsvkdlavpvavseyihqslggesilevm
    ateghlpqlsspdvvvpvllrhiryaiar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z7wB (B:)
    gplgsmglaqeahnvrvlgsgpqtvvlahgfgtdqsvwkylvphlvedyrvvlfdimgag
    ttnptyfnferysslegyagdviaileelqisscvyvghsvsamigviasvtrpdlftkl
    vtvagsprylndpdyfggfdldelhelfeamkenykawcsgfaplcvgadmeslavqefs
    rtlfnmrpdialsilqtifysdvrpllphvtvpchiiqsvkdlavpvavseyihqslgge
    silevmateghlpqlsspdvvvpvllrhiryaiarpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z7wB (B:)
    gsmglaqeahnvrvlgsgpqtvvlahgfgtdqsvwkylvphlvedyrvvlfdimgagttn
    ptyfnferysslegyagdviaileelqisscvyvghsvsamigviasvtrpdlftklvtv
    agsprylndpdyfggfdldelhelfeamkenykawcsgfaplcvgadmeslavqefsrtl
    fnmrpdialsilqtifysdvrpllphvtvpchiiqsvkdlavpvavseyihqslggesil
    evmateghlpqlsspdvvvpvllrhiryaia