PDB entry 5z7e

View 5z7e on RCSB PDB site
Description: Horse Heart Myoglobin Mutant - H93M
Class: oxygen storage
Keywords: horse heart myoglobin mutant, H93M, OXYGEN STORAGE
Deposited on 2018-01-28, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Equus caballus [TaxId:9796]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68082 (0-152)
    • engineered mutation (92)
  Domains in SCOPe 2.08: d5z7ea_
• Heterogens: NO2, SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5z7eA (A:)
  glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
  lkkhgtvvltalggilkkkghheaelkplaqsmatkhkipikylefisdaiihvlhskhp
  gdfgadaqgamtkalelfrndiaakykelgfqg