PDB entry 5z6u

View 5z6u on RCSB PDB site
Description: Crystal strcuture of D-xylose reductase from Scheffersomyces stipitis
Class: oxidoreductase
Keywords: Pontose metabolism, xylose reductase, Scheffersomyces stipitis, OXIDOREDUCTASE
Deposited on 2018-01-25, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P)H-dependent D-xylose reductase
    Species: Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) [TaxId:322104]
    Gene: XYL1, PICST_89614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z6ua_
  • Chain 'B':
    Compound: NAD(P)H-dependent D-xylose reductase
    Species: Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) [TaxId:322104]
    Gene: XYL1, PICST_89614
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z6ub_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z6uA (A:)
    msyyhhhhhhdydiptteniyfqghmpsiklnsgydmpavgfgcwkvdvdtcseqiyrai
    ktgyrlfdgaedyaneklvgagvkkaidegivkredlfltsklwnnyhhpdnvekalnrt
    lsdlqvdyvdlflihfpvtfkfvpleekyppgfycgkgdnfdyedvpiletwkaleklvk
    agkirsigvsnfpgallldllrgatikpsvlqvehhpylqqprliefaqsrgiavtayss
    fgpqsfvelnqgralntsplfenetikaiaakhgkspaqvllrwssqrgiaiipksntvp
    rllenkdvnsfdldeqdfadiakldinlrfndpwdwdkipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z6uA (A:)
    mpsiklnsgydmpavgfgcwkvdvdtcseqiyraiktgyrlfdgaedyaneklvgagvkk
    aidegivkredlfltsklwnnyhhpdnvekalnrtlsdlqvdyvdlflihfpvtfkfvpl
    eekyppgfycgkgdnfdyedvpiletwkaleklvkagkirsigvsnfpgallldllrgat
    ikpsvlqvehhpylqqprliefaqsrgiavtayssfgpqsfvelnqgralntsplfenet
    ikaiaakhgkspaqvllrwssqrgiaiipksntvprllenkdvnsfdldeqdfadiakld
    inlrfndpwdwdkipifv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z6uB (B:)
    msyyhhhhhhdydiptteniyfqghmpsiklnsgydmpavgfgcwkvdvdtcseqiyrai
    ktgyrlfdgaedyaneklvgagvkkaidegivkredlfltsklwnnyhhpdnvekalnrt
    lsdlqvdyvdlflihfpvtfkfvpleekyppgfycgkgdnfdyedvpiletwkaleklvk
    agkirsigvsnfpgallldllrgatikpsvlqvehhpylqqprliefaqsrgiavtayss
    fgpqsfvelnqgralntsplfenetikaiaakhgkspaqvllrwssqrgiaiipksntvp
    rllenkdvnsfdldeqdfadiakldinlrfndpwdwdkipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z6uB (B:)
    mpsiklnsgydmpavgfgcwkvdvdtcseqiyraiktgyrlfdgaedyaneklvgagvkk
    aidegivkredlfltsklwnnyhhpdnvekalnrtlsdlqvdyvdlflihfpvtfkfvpl
    eekyppgfycgkgdnfdyedvpiletwkaleklvkagkirsigvsnfpgallldllrgat
    ikpsvlqvehhpylqqprliefaqsrgiavtayssfgpqsfvelnqgralntsplfenet
    ikaiaakhgkspaqvllrwssqrgiaiipksntvprllenkdvnsfdldeqdfadiakld
    inlrfndpwdwdkipifv