PDB entry 5z50

View 5z50 on RCSB PDB site
Description: Crystal structure of PaCysB regulatory domain
Class: DNA binding protein
Keywords: CysB, DNA complex, DNA BINDING PROTEIN
Deposited on 2018-01-15, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cys regulon transcriptional activator
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z50a_
  • Chain 'B':
    Compound: Cys regulon transcriptional activator
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z50b_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z50A (A:)
    snekkgtlsiatthtqaryalpnvisgfikqypdvslhmhqgtpmqiaemaadgtvdfai
    atealelfgdlimmpcyrwnrcvivphghpltklpkltlealaeqpivtyvfgftgrskl
    deafsqrglvpkvvftaadadviktyvrlglgvgivahmavdpkldndlvildashlfes
    svtkigfrrgtflrgfmcdfiekfaphltrellakavqchnkaeldelfdgielpvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z50A (A:)
    gtlsiatthtqaryalpnvisgfikqypdvslhmhqgtpmqiaemaadgtvdfaiateal
    elfgdlimmpcyrwnrcvivphghpltklpkltlealaeqpivtyvfgftgrskldeafs
    qrglvpkvvftaadadviktyvrlglgvgivahmavdpkldndlvildashlfessvtki
    gfrrgtflrgfmcdfiekfaphltrellakavqchnkaeldelfdgielpvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z50B (B:)
    snekkgtlsiatthtqaryalpnvisgfikqypdvslhmhqgtpmqiaemaadgtvdfai
    atealelfgdlimmpcyrwnrcvivphghpltklpkltlealaeqpivtyvfgftgrskl
    deafsqrglvpkvvftaadadviktyvrlglgvgivahmavdpkldndlvildashlfes
    svtkigfrrgtflrgfmcdfiekfaphltrellakavqchnkaeldelfdgielpvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z50B (B:)
    gtlsiatthtqaryalpnvisgfikqypdvslhmhqgtpmqiaemaadgtvdfaiateal
    elfgdlimmpcyrwnrcvivphghpltklpkltlealaeqpivtyvfgftgrskldeafs
    qrglvpkvvftaadadviktyvrlglgvgivahmavdpkldndlvildashlfessvtki
    gfrrgtflrgfmcdfiekfaphltrellakavqchnkaeldelfdgielpvy