PDB entry 5z4b

View 5z4b on RCSB PDB site
Description: GB1 structure determination in living eukaryotic cells by in-cell NMR spectroscopy
Class: immune system
Keywords: protein, immune system
Deposited on 2018-01-10, released 2019-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein LG
  Species: Finegoldia magna [TaxId:1260]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q53291 (2-56)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d5z4ba1, d5z4ba2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5z4bA (A:)
  mgtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte