PDB entry 5z48

View 5z48 on RCSB PDB site
Description: Crystal structure of pyrrolidone carboxylate peptidase I from Deinococcus radiodurans R1 bound to pyroglutamate
Class: hydrolase
Keywords: omega peptidase, pyroglutamate, exopeptidase, HYDROLASE
Deposited on 2018-01-10, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyrrolidone-carboxylate peptidase
    Species: Deinococcus radiodurans R1 [TaxId:243230]
    Gene: pcp, DR_0490
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RX25 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5z48a1, d5z48a2
  • Chain 'B':
    Compound: Pyrrolidone-carboxylate peptidase
    Species: Deinococcus radiodurans R1 [TaxId:243230]
    Gene: pcp, DR_0490
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RX25 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5z48b1, d5z48b2
  • Heterogens: NA, DMS, PCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z48A (A:)
    gsmptllltgfepfhthpdnpsaqaaqelhglelpggwgvhsallpvephaagaaltrll
    seqdpgavlltglaagrpqvtlervgvgvmdfqipdnagqtyrdqpiepdapaaylatlp
    lrailaawreaeipgdisnsaglyvcnfvlyhalhwlrehgrgavpcgflhvpanaaval
    avpadrpplpylpqseitravrvaaeaitaqssvlqmgkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z48A (A:)
    gsmptllltgfepfhthpdnpsaqaaqelhglelpggwgvhsallpvephaagaaltrll
    seqdpgavlltglaagrpqvtlervgvgvmdfqipdnagqtyrdqpiepdapaaylatlp
    lrailaawreaeipgdisnsaglyvcnfvlyhalhwlrehgrgavpcgflhvpanaaval
    avpadrpplpylpqseitravrvaaeaitaqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z48B (B:)
    gsmptllltgfepfhthpdnpsaqaaqelhglelpggwgvhsallpvephaagaaltrll
    seqdpgavlltglaagrpqvtlervgvgvmdfqipdnagqtyrdqpiepdapaaylatlp
    lrailaawreaeipgdisnsaglyvcnfvlyhalhwlrehgrgavpcgflhvpanaaval
    avpadrpplpylpqseitravrvaaeaitaqssvlqmgkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z48B (B:)
    gsmptllltgfepfhthpdnpsaqaaqelhglelpggwgvhsallpvephaagaaltrll
    seqdpgavlltglaagrpqvtlervgvgvmdfqipdnagqtyrdqpiepdapaaylatlp
    lrailaawreaeipgdisnsaglyvcnfvlyhalhwlrehgrgavpcgflhvpanaaval
    avpadrpplpylpqseitravrvaaeaitaqss