PDB entry 5z2j

View 5z2j on RCSB PDB site
Description: structure of S38A mutant metal-free periplasmic metal binding protein from candidatus liberibacter asiaticus
Class: metal binding protein
Keywords: ABC transporter Periplasmic solute binding protein, METAL BINDING PROTEIN
Deposited on 2018-01-02, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic solute binding protein
    Species: Liberibacter asiaticus (strain psy62) [TaxId:537021]
    Gene: CLIBASIA_02120
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6XF58 (Start-274)
      • engineered mutation (37)
    Domains in SCOPe 2.07: d5z2ja_
  • Heterogens: ACT, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z2jA (A:)
    ttqkkvvlssfsiigditqniakdlvtvttlveagndahsyqvtsadaikiqnadlilcn
    glhleetymkyftnlkkgtkiitvtdginpigvsedtsvdsepnphawmsltnamiyien
    irkaltaldpsnakkyelnareysekirnsilplktriekvdpekrwfvtsegclvylae
    dfgfkslylwpinsdserspsmmrhainqmrshkikfifsestnsdqpakqvayetnasy
    ggvlyvdslskpdgpaptyldllrfsltkivdtlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z2jA (A:)
    kkvvlssfsiigditqniakdlvtvttlveagndahsyqvtsadaikiqnadlilcnglh
    leetymkyftnlkkgtkiitvtdginpigvsedtsvdsepnphawmsltnamiyienirk
    altaldpsnakkyelnareysekirnsilplktriekvdpekrwfvtsegclvylaedfg
    fkslylwpinsdrspsmmrhainqmrshkikfifsestnsdqpakqvayetnasyggvly
    vdslskpdgpaptyldllrfsltkivdtlf