PDB entry 5z2a

View 5z2a on RCSB PDB site
Description: Crystal Structure of Bacillus sp. TB-90 Urate Oxidase Improved by Humidity Control at 86% RH.
Class: oxidoreductase
Keywords: protein engineering, enzyme, loop flexibility, entropy of activation, OXIDOREDUCTASE
Deposited on 2017-12-31, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z2aa1, d5z2aa2
  • Chain 'B':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z2ab1, d5z2ab2
  • Heterogens: AZA, OXY, SO4, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z2aA (A:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcft
    vtqedlphenil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z2aA (A:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcft
    vtq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z2aB (B:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcft
    vtqedlphenil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z2aB (B:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcft
    vtq