PDB entry 5z27

View 5z27 on RCSB PDB site
Description: Crystal structure of highly active BTUO mutant P287G without dehydration
Class: oxidoreductase
Keywords: protein engineering, enzyme, loop flexibility, entropy of activation, OXIDOREDUCTASE
Deposited on 2017-12-29, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z27a1, d5z27a2
  • Chain 'B':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z27b1, d5z27b2
  • Heterogens: AZA, SO4, OXY, K, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z27A (A:)
    tkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllts
    ftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeip
    fettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsg
    nsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvf
    hetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeigesegkvyteprppy
    gfqcftvtqedlphenilmfsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z27A (A:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkigkvyteprppygfqcftvtq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z27B (B:)
    tkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllts
    ftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeip
    fettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsg
    nsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvf
    hetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeigesegkvyteprppy
    gfqcftvtqedlphenilmfsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z27B (B:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeiegkvyteprppygfqcftvtq