PDB entry 5z18

View 5z18 on RCSB PDB site
Description: The crystal structure of Ruminococcus gnavus beta-glucuronidase
Class: hydrolase
Keywords: beta-glucuronidase, GH2, HYDROLASE
Deposited on 2017-12-25, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucuronidase
    Species: Ruminococcus gnavus [TaxId:33038]
    Gene: uidA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z18a1, d5z18a2, d5z18a3
  • Chain 'B':
    Compound: beta-glucuronidase
    Species: Ruminococcus gnavus [TaxId:33038]
    Gene: uidA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z18b1, d5z18b2, d5z18b3
  • Chain 'C':
    Compound: beta-glucuronidase
    Species: Ruminococcus gnavus [TaxId:33038]
    Gene: uidA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z18c1, d5z18c2, d5z18c3
  • Chain 'D':
    Compound: beta-glucuronidase
    Species: Ruminococcus gnavus [TaxId:33038]
    Gene: uidA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z18d1, d5z18d2, d5z18d3
  • Chain 'E':
    Compound: beta-glucuronidase
    Species: Ruminococcus gnavus [TaxId:33038]
    Gene: uidA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z18e1, d5z18e2, d5z18e3
  • Chain 'F':
    Compound: beta-glucuronidase
    Species: Ruminococcus gnavus [TaxId:33038]
    Gene: uidA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z18f1, d5z18f2, d5z18f3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z18A (A:)
    mhhhhhhssgvdlgtenlyfqsngmleyselypiqneyrmmqsldgmwkfqfdpeeigkk
    sgwenglpapvsmpvpssfadfftdhkerdycgdfwyetefylpaewrnkkiwlrfgsit
    hrgtvycngmeitsheggflpvladistvakpgqvnqvvvkinnelnetslpcgatkiln
    ngrklakpyfdffnysglqrsvwvialpeesvkdysvdyelcgtdalvkyevvttgehpv
    ivrlldaegelvaetegkegilqvanarlwevrnaylyqivilitdgngvldeyrekigi
    rtvriegtkillndrpvylkgfgkhedfpilgrgfhwgivkrdfeclkwtnancfrtshy
    pyaeewyqfadeegfliidevpavgmmrstrnfvaagsgnytyffealtvpellkshiad
    teemitrdknhpsviawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknsk
    pelckcyplcdficlnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtd
    tmaglhklpsimwseeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhk
    gvftrdrqpkaaavvfkdrwekknelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z18A (A:)
    leyselypiqneyrmmqsldgmwkfqfdpeeigkksgwenglpapvsmpvpssfadfftd
    hkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvlad
    istvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwvi
    alpeesvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqva
    narlwevrnaylyqivilitdgngvldeyrekigirtvriegtkillndrpvylkgfgkh
    edfpilgrgfhwgivkrdfeclkwtnancfrtshypyaeewyqfadeegfliidevpavg
    mmrstytyffealtvpellkshiadteemitrdknhpsviawslfnepetitdyayeyfk
    evfaaaetydfqsrpmtgafeknskpelckcyplcdficlnryygwyisggpeieeaeel
    frdemdrwkakelnvpfvftefgtdtmaglhklpsimwseeyqkeylemnfrvfdsyefv
    qgelawnfadfqttegimrvdgnhkgvftrdrqpkaaavvfkdrwe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z18B (B:)
    mhhhhhhssgvdlgtenlyfqsngmleyselypiqneyrmmqsldgmwkfqfdpeeigkk
    sgwenglpapvsmpvpssfadfftdhkerdycgdfwyetefylpaewrnkkiwlrfgsit
    hrgtvycngmeitsheggflpvladistvakpgqvnqvvvkinnelnetslpcgatkiln
    ngrklakpyfdffnysglqrsvwvialpeesvkdysvdyelcgtdalvkyevvttgehpv
    ivrlldaegelvaetegkegilqvanarlwevrnaylyqivilitdgngvldeyrekigi
    rtvriegtkillndrpvylkgfgkhedfpilgrgfhwgivkrdfeclkwtnancfrtshy
    pyaeewyqfadeegfliidevpavgmmrstrnfvaagsgnytyffealtvpellkshiad
    teemitrdknhpsviawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknsk
    pelckcyplcdficlnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtd
    tmaglhklpsimwseeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhk
    gvftrdrqpkaaavvfkdrwekknelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z18B (B:)
    leyselypiqneyrmmqsldgmwkfqfdpeeigkksgwenglpapvsmpvpssfadfftd
    hkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvlad
    istvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwvi
    alpeesvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqva
    narlwevrnaylyqivilitdgngvldeyrekigirtvriegtkillndrpvylkgfgkh
    edfpilgrgfhwgivkrdfeclkwtnancfrtshypyaeewyqfadeegfliidevpavg
    mmrstytyffealtvpellkshiadteemitrdknhpsviawslfnepetitdyayeyfk
    evfaaaetydfqsrpmtgafeknskpelckcyplcdficlnryygwyisggpeieeaeel
    frdemdrwkakelnvpfvftefgtdtmaglhklpsimwseeyqkeylemnfrvfdsyefv
    qgelawnfadfqttegimrvdgnhkgvftrdrqpkaaavvfkdrwe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5z18C (C:)
    mhhhhhhssgvdlgtenlyfqsngmleyselypiqneyrmmqsldgmwkfqfdpeeigkk
    sgwenglpapvsmpvpssfadfftdhkerdycgdfwyetefylpaewrnkkiwlrfgsit
    hrgtvycngmeitsheggflpvladistvakpgqvnqvvvkinnelnetslpcgatkiln
    ngrklakpyfdffnysglqrsvwvialpeesvkdysvdyelcgtdalvkyevvttgehpv
    ivrlldaegelvaetegkegilqvanarlwevrnaylyqivilitdgngvldeyrekigi
    rtvriegtkillndrpvylkgfgkhedfpilgrgfhwgivkrdfeclkwtnancfrtshy
    pyaeewyqfadeegfliidevpavgmmrstrnfvaagsgnytyffealtvpellkshiad
    teemitrdknhpsviawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknsk
    pelckcyplcdficlnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtd
    tmaglhklpsimwseeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhk
    gvftrdrqpkaaavvfkdrwekknelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z18C (C:)
    leyselypiqneyrmmqsldgmwkfqfdpeeigkksgwenglpapvsmpvpssfadfftd
    hkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvlad
    istvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwvi
    alpeesvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqva
    narlwevrnaylyqivilitdgngvldeyrekigirtvriegtkillndrpvylkgfgkh
    edfpilgrgfhwgivkrdfeclkwtnancfrtshypyaeewyqfadeegfliidevpavg
    mmrstytyffealtvpellkshiadteemitrdknhpsviawslfnepetitdyayeyfk
    evfaaaetydfqsrpmtgafeknskpelckcyplcdficlnryygwyisggpeieeaeel
    frdemdrwkakelnvpfvftefgtdtmaglhklpsimwseeyqkeylemnfrvfdsyefv
    qgelawnfadfqttegimrvdgnhkgvftrdrqpkaaavvfkdrwekk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5z18D (D:)
    mhhhhhhssgvdlgtenlyfqsngmleyselypiqneyrmmqsldgmwkfqfdpeeigkk
    sgwenglpapvsmpvpssfadfftdhkerdycgdfwyetefylpaewrnkkiwlrfgsit
    hrgtvycngmeitsheggflpvladistvakpgqvnqvvvkinnelnetslpcgatkiln
    ngrklakpyfdffnysglqrsvwvialpeesvkdysvdyelcgtdalvkyevvttgehpv
    ivrlldaegelvaetegkegilqvanarlwevrnaylyqivilitdgngvldeyrekigi
    rtvriegtkillndrpvylkgfgkhedfpilgrgfhwgivkrdfeclkwtnancfrtshy
    pyaeewyqfadeegfliidevpavgmmrstrnfvaagsgnytyffealtvpellkshiad
    teemitrdknhpsviawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknsk
    pelckcyplcdficlnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtd
    tmaglhklpsimwseeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhk
    gvftrdrqpkaaavvfkdrwekknelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z18D (D:)
    leyselypiqneyrmmqsldgmwkfqfdpeeigkksgwenglpapvsmpvpssfadfftd
    hkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvlad
    istvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwvi
    alpeesvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqva
    narlwevrnaylyqivilitdgngvldeyrekigirtvriegtkillndrpvylkgfgkh
    edfpilgrgfhwgivkrdfeclkwtnancfrtshypyaeewyqfadeegfliidevpavg
    mmrsytyffealtvpellkshiadteemitrdknhpsviawslfnepetitdyayeyfke
    vfaaaetydfqsrpmtgafeknskpelckcyplcdficlnryygwyisggpeieeaeelf
    rdemdrwkakelnvpfvftefgtdtmaglhklpsimwseeyqkeylemnfrvfdsyefvq
    gelawnfadfqttegimrvdgnhkgvftrdrqpkaaavvfkdrwekknelf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5z18E (E:)
    mhhhhhhssgvdlgtenlyfqsngmleyselypiqneyrmmqsldgmwkfqfdpeeigkk
    sgwenglpapvsmpvpssfadfftdhkerdycgdfwyetefylpaewrnkkiwlrfgsit
    hrgtvycngmeitsheggflpvladistvakpgqvnqvvvkinnelnetslpcgatkiln
    ngrklakpyfdffnysglqrsvwvialpeesvkdysvdyelcgtdalvkyevvttgehpv
    ivrlldaegelvaetegkegilqvanarlwevrnaylyqivilitdgngvldeyrekigi
    rtvriegtkillndrpvylkgfgkhedfpilgrgfhwgivkrdfeclkwtnancfrtshy
    pyaeewyqfadeegfliidevpavgmmrstrnfvaagsgnytyffealtvpellkshiad
    teemitrdknhpsviawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknsk
    pelckcyplcdficlnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtd
    tmaglhklpsimwseeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhk
    gvftrdrqpkaaavvfkdrwekknelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z18E (E:)
    leyselypiqneyrmmqsldgmwkfqfdpeeigkksgwenglpapvsmpvpssfadfftd
    hkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvlad
    istvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwvi
    alpeesvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqva
    narlwevrnaylyqivilitdgngvldeyrekigirtvriegtkillndrpvylkgfgkh
    edfpilgrgfhwgivkrdfeclkwtnancfrtshypyaeewyqfadeegfliidevpavg
    mmrstyffealtvpellkshiadteemitrdknhpsviawslfnepetitdyayeyfkev
    faaaetydfqsrpmtgafeknskpelckcyplcdficlnryygwyisggpeieeaeelfr
    demdrwkakelnvpfvftefgtdtmaglhklpsimwseeyqkeylemnfrvfdsyefvqg
    elawnfadfqttegimrvdgnhkgvftrdrqpkaaavvfkdrwekk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5z18F (F:)
    mhhhhhhssgvdlgtenlyfqsngmleyselypiqneyrmmqsldgmwkfqfdpeeigkk
    sgwenglpapvsmpvpssfadfftdhkerdycgdfwyetefylpaewrnkkiwlrfgsit
    hrgtvycngmeitsheggflpvladistvakpgqvnqvvvkinnelnetslpcgatkiln
    ngrklakpyfdffnysglqrsvwvialpeesvkdysvdyelcgtdalvkyevvttgehpv
    ivrlldaegelvaetegkegilqvanarlwevrnaylyqivilitdgngvldeyrekigi
    rtvriegtkillndrpvylkgfgkhedfpilgrgfhwgivkrdfeclkwtnancfrtshy
    pyaeewyqfadeegfliidevpavgmmrstrnfvaagsgnytyffealtvpellkshiad
    teemitrdknhpsviawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknsk
    pelckcyplcdficlnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtd
    tmaglhklpsimwseeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhk
    gvftrdrqpkaaavvfkdrwekknelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z18F (F:)
    leyselypiqneyrmmqsldgmwkfqfdpeeigkksgwenglpapvsmpvpssfadfftd
    hkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvlad
    istvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwvi
    alpeesvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqva
    narlwevrnaylyqivilitdgngvldeyrekigirtvriegtkillndrpvylkgfgkh
    edfpilgrgfhwgivkrdfeclkwtnancfrtshypyaeewyqfadeegfliidevpavg
    mmrsffealtvpellkshiadteemitrdknhpsviawslfnepetitdyayeyfkevfa
    aaetydfqsrpmtgafeknskpelckcyplcdficlnryygwyisggpeieeaeelfrde
    mdrwkakelnvpfvftefgtdtmaglhklpsimwseeyqkeylemnfrvfdsyefvqgel
    awnfadfqttegimrvdgnhkgvftrdrqpkaaavvfkdrwe