PDB entry 5z0u

View 5z0u on RCSB PDB site
Description: Thermoactinomyces vulgaris R-47 alpha-amylase I (TVA I) 11 residues (from A363 to N373) deletion mutant (Del11)
Class: hydrolase
Keywords: alpha-amylase, neopullulanase, GH13, HYDROLASE
Deposited on 2017-12-21, released 2018-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neopullulanase 1
    Species: Thermoactinomyces vulgaris [TaxId:2026]
    Gene: tvaI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z0ua1, d5z0ua2, d5z0ua3
  • Heterogens: CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5z0uA (A:)
    aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
    vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
    ipnfktpdwlkngvmyqifpdrfyngdssndvqtgsytyngtptekkawgssvyadpgyd
    nslvffggdlagidqklgyikktlganilylnpifkaptnhkydtqdymavdpafgdnst
    lqtlindihstangpkgylildgvfnhtgdshpwfdkynnfssqgayesqsspwynyytf
    ytwpdsyasflgfnslpklnygnsgsavrgviynnsnsvaktylnppysvdgwrldaaqy
    vdhqiwsefrnavkgvnsnaaiigeywgnanpwtaqgnqwdaatnfdgftqpvsewitgk
    dyqnnsasisttqfdswlrgtranyptnvqqsmmnflsnhditrfatrsggdlwktylal
    ifqmtyvgtptiyygdeygmqggadpdnrrsfdwsqatpsnsavaltqklitirnqypal
    rtgsfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdki
    tghsytvqngmvtvavdghygavlaq