PDB entry 5z0j

View 5z0j on RCSB PDB site
Description: Crystal structure of copper-bound tyrosinase from Streptomyces castaneoglobisporus in complex with the caddie protein obtained by soaking in the hydroxylamine-containing solution for 2 h at 277 K
Class: oxidoreductase/metal binding protein
Keywords: tyrosinase, catalytic mechanism, OXIDOREDUCTASE-METAL BINDING PROTEIN complex
Deposited on 2017-12-19, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosinase
    Species: Streptomyces castaneoglobisporus [TaxId:79261]
    Gene: TYRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83WS2 (Start-272)
      • conflict (122)
      • expression tag (273-276)
    Domains in SCOPe 2.07: d5z0ja1, d5z0ja2
  • Chain 'B':
    Compound: MelC
    Species: Streptomyces castaneoglobisporus [TaxId:79261]
    Gene: ORF378
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83WS1
      • see sequence details (97)
    Domains in SCOPe 2.07: d5z0jb_
  • Heterogens: CU, PER, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z0jA (A:)
    mtvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsfl
    pwhrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpf
    aastgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnh
    legwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptgg
    tpdvvdlnetmkpwntvrpadlldhtayytfdalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z0jA (A:)
    tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
    whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
    astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
    egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
    pdvvdlnetmkpwntvrpadlldhtayytfdalehh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z0jB (B:)
    mpeitrrraltaaaavaatasaavtlaapaasaaghhepaapesfdevykgrriqgrpag
    ggahhhehgggyevfvdgvqlhvmrnadgswisvvshfdpvptpraaaraavdelqgapl
    lpfpanlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z0jB (B:)
    aapesfdevykgrriqgrpaehgggyevfvdgvqlhvmrnadgswisvvshfdpvptpra
    aaraavdelqgapllpf