PDB entry 5yz6

View 5yz6 on RCSB PDB site
Description: Solution structure of LysM domain from a chitinase derived from Volvox carteri
Class: hydrolase
Keywords: lysin motif, chitin-specific, CBM50, SUGAR BINDING PROTEIN, HYDROLASE
Deposited on 2017-12-13, released 2018-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitinase, lysozyme
    Species: Volvox carteri f. nagariensis [TaxId:3068]
    Gene: chi4, VOLCADRAFT_127242
    Database cross-references and differences (RAF-indexed):
    • Uniprot D8UFB5 (1-48)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5yz6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yz6A (A:)
    mgctytiqpgdtfwaiaqrrgttvdviqslnpgvvptrlqvgqvinvpc