PDB entry 5yy5

View 5yy5 on RCSB PDB site
Description: Structural definition of a unique neutralization epitope on the receptor-binding domain of MERS-CoV spike glycoprotein
Class: viral protein
Keywords: MERS-CoV, spike glycorptotein, neutralizing antibody, VIRAL PROTEIN
Deposited on 2017-12-08, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MERS-CoV RBD
    Species: Middle East respiratory syndrome coronavirus [TaxId:1335626]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5YY5 (0-208)
  • Chain 'B':
    Compound: MERS-CoV RBD
    Species: Middle East respiratory syndrome coronavirus [TaxId:1335626]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5YY5 (0-208)
  • Chain 'C':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5YY5 (0-108)
    Domains in SCOPe 2.07: d5yy5c_
  • Chain 'D':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5YY5 (0-104)
    Domains in SCOPe 2.07: d5yy5d_
  • Chain 'H':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5YY5 (0-99)
    Domains in SCOPe 2.07: d5yy5h_
  • Chain 'L':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5YY5 (0-111)
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yy5C (C:)
    gvqlvesggglvqpgrslrlscaasgftfsnyamywvrqapgkglewvalisydistdyy
    adsvkgrftisrdnskntiylqmnnlrtedtalyyctntyywgqgtlvt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yy5D (D:)
    ltqspsasgtpgqrvtiscsgsssnignnyvywyqqlpgtapklliywndqrpsgvpdrf
    sgsksgtsaslaisglrsedeadyycaawddslsgavfgggtqlt
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yy5H (H:)
    evqlvesggglvqpgrslrlscaasgftfsnyamywvrqapgkglewvalisydistdyy
    adsvkgrftisrdnskntiylqmnnlrtedtalyyctntyywgqgtlvtvs
    

  • Chain 'L':
    No sequence available.