PDB entry 5yxt

View 5yxt on RCSB PDB site
Description: Glycoside hydrolase family 8 Xylanase
Class: hydrolase
Keywords: Xylanase, HYDROLASE
Deposited on 2017-12-07, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Reducing end xylose-releasing exo-oligoxylanase
    Species: Paenibacillus barengoltzii G22 [TaxId:1235795]
    Gene: C812_03928
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yxta_
  • Chain 'B':
    Compound: Reducing end xylose-releasing exo-oligoxylanase
    Species: Paenibacillus barengoltzii G22 [TaxId:1235795]
    Gene: C812_03928
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yxtb_
  • Chain 'C':
    Compound: Reducing end xylose-releasing exo-oligoxylanase
    Species: Paenibacillus barengoltzii G22 [TaxId:1235795]
    Gene: C812_03928
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yxtc_
  • Chain 'D':
    Compound: Reducing end xylose-releasing exo-oligoxylanase
    Species: Paenibacillus barengoltzii G22 [TaxId:1235795]
    Gene: C812_03928
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yxtd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yxtA (A:)
    mkehqgayctgtyrnllaeygygeeaiqrrldetweqlfegdeetriyypsgedmgymld
    tgnldvrtegmsygmmmavqydrqdvfdriwkwtvtymymtegdnagyfawscapdgkrl
    sngpapdgeeyfalallfashrwgdreapfnygtqardllrtclhkgedgpgypmwnpdn
    klikfvpncefsdpsyhlphfyelfalwaypedrafwkeaaeasrqylhlachpvtglap
    eyayydgtpnnergyghffsdayrvaanlgldwewfaadpwqreavgkiqaffadkeped
    yrrytisgepfeepalhpvgllatnamaslaadgpqakacvdlfwntpvrtgkrryydnc
    lylfallalsgnyriwmprgea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yxtA (A:)
    mkehqgayctgtyrnllaeygygeeaiqrrldetweqlfegdeetriyypsgedmgymld
    tgnldvrtegmsygmmmavqydrqdvfdriwkwtvtymymtegdnagyfawscapdgkrl
    sngpapdgeeyfalallfashrwgdreapfnygtqardllrtclhkgedgpgypmwnpdn
    klikfvpncefsdpsyhlphfyelfalwaypedrafwkeaaeasrqylhlachpvtglap
    eyayydgtpnnergyghffsdayrvaanlgldwewfaadpwqreavgkiqaffadkeped
    yrrytisgepfeepalhpvgllatnamaslaadgpqakacvdlfwntpvrtgkrryydnc
    lylfallalsgnyriwmpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yxtB (B:)
    mkehqgayctgtyrnllaeygygeeaiqrrldetweqlfegdeetriyypsgedmgymld
    tgnldvrtegmsygmmmavqydrqdvfdriwkwtvtymymtegdnagyfawscapdgkrl
    sngpapdgeeyfalallfashrwgdreapfnygtqardllrtclhkgedgpgypmwnpdn
    klikfvpncefsdpsyhlphfyelfalwaypedrafwkeaaeasrqylhlachpvtglap
    eyayydgtpnnergyghffsdayrvaanlgldwewfaadpwqreavgkiqaffadkeped
    yrrytisgepfeepalhpvgllatnamaslaadgpqakacvdlfwntpvrtgkrryydnc
    lylfallalsgnyriwmprgea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yxtB (B:)
    mkehqgayctgtyrnllaeygygeeaiqrrldetweqlfegdeetriyypsgedmgymld
    tgnldvrtegmsygmmmavqydrqdvfdriwkwtvtymymtegdnagyfawscapdgkrl
    sngpapdgeeyfalallfashrwgdreapfnygtqardllrtclhkgedgpgypmwnpdn
    klikfvpncefsdpsyhlphfyelfalwaypedrafwkeaaeasrqylhlachpvtglap
    eyayydgtpnnergyghffsdayrvaanlgldwewfaadpwqreavgkiqaffadkeped
    yrrytisgepfeepalhpvgllatnamaslaadgpqakacvdlfwntpvrtgkrryydnc
    lylfallalsgnyriwmpr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yxtC (C:)
    mkehqgayctgtyrnllaeygygeeaiqrrldetweqlfegdeetriyypsgedmgymld
    tgnldvrtegmsygmmmavqydrqdvfdriwkwtvtymymtegdnagyfawscapdgkrl
    sngpapdgeeyfalallfashrwgdreapfnygtqardllrtclhkgedgpgypmwnpdn
    klikfvpncefsdpsyhlphfyelfalwaypedrafwkeaaeasrqylhlachpvtglap
    eyayydgtpnnergyghffsdayrvaanlgldwewfaadpwqreavgkiqaffadkeped
    yrrytisgepfeepalhpvgllatnamaslaadgpqakacvdlfwntpvrtgkrryydnc
    lylfallalsgnyriwmprgea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yxtC (C:)
    mkehqgayctgtyrnllaeygygeeaiqrrldetweqlfegdeetriyypsgedmgymld
    tgnldvrtegmsygmmmavqydrqdvfdriwkwtvtymymtegdnagyfawscapdgkrl
    sngpapdgeeyfalallfashrwgdreapfnygtqardllrtclhkgedgpgypmwnpdn
    klikfvpncefsdpsyhlphfyelfalwaypedrafwkeaaeasrqylhlachpvtglap
    eyayydgtpnnergyghffsdayrvaanlgldwewfaadpwqreavgkiqaffadkeped
    yrrytisgepfeepalhpvgllatnamaslaadgpqakacvdlfwntpvrtgkrryydnc
    lylfallalsgnyriwmpr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yxtD (D:)
    mkehqgayctgtyrnllaeygygeeaiqrrldetweqlfegdeetriyypsgedmgymld
    tgnldvrtegmsygmmmavqydrqdvfdriwkwtvtymymtegdnagyfawscapdgkrl
    sngpapdgeeyfalallfashrwgdreapfnygtqardllrtclhkgedgpgypmwnpdn
    klikfvpncefsdpsyhlphfyelfalwaypedrafwkeaaeasrqylhlachpvtglap
    eyayydgtpnnergyghffsdayrvaanlgldwewfaadpwqreavgkiqaffadkeped
    yrrytisgepfeepalhpvgllatnamaslaadgpqakacvdlfwntpvrtgkrryydnc
    lylfallalsgnyriwmprgea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yxtD (D:)
    mkehqgayctgtyrnllaeygygeeaiqrrldetweqlfegdeetriyypsgedmgymld
    tgnldvrtegmsygmmmavqydrqdvfdriwkwtvtymymtegdnagyfawscapdgkrl
    sngpapdgeeyfalallfashrwgdreapfnygtqardllrtclhkgedgpgypmwnpdn
    klikfvpncefsdpsyhlphfyelfalwaypedrafwkeaaeasrqylhlachpvtglap
    eyayydgtpnnergyghffsdayrvaanlgldwewfaadpwqreavgkiqaffadkeped
    yrrytisgepfeepalhpvgllatnamaslaadgpqakacvdlfwntpvrtgkrryydnc
    lylfallalsgnyriwmpr