PDB entry 5yxk

View 5yxk on RCSB PDB site
Description: High resolution crystal structure of Human B7-2 IgV domain in P21 space group
Class: immune system
Keywords: B7-2, co-stimulatory molecule, Ig super family, CD86, IMMUNE SYSTEM
Deposited on 2017-12-05, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-lymphocyte activation antigen CD86
    Species: Homo sapiens [TaxId:9606]
    Gene: CD86, CD28LG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42081 (2-110)
      • expression tag (1)
    Domains in SCOPe 2.07: d5yxka1, d5yxka2
  • Chain 'B':
    Compound: T-lymphocyte activation antigen CD86
    Species: Homo sapiens [TaxId:9606]
    Gene: CD86, CD28LG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42081 (2-110)
      • expression tag (1)
    Domains in SCOPe 2.07: d5yxkb1, d5yxkb2
  • Chain 'C':
    Compound: T-lymphocyte activation antigen CD86
    Species: Homo sapiens [TaxId:9606]
    Gene: CD86, CD28LG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42081 (2-110)
      • expression tag (1)
    Domains in SCOPe 2.07: d5yxkc1, d5yxkc2
  • Chain 'D':
    Compound: T-lymphocyte activation antigen CD86
    Species: Homo sapiens [TaxId:9606]
    Gene: CD86, CD28LG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42081 (2-110)
      • expression tag (1)
    Domains in SCOPe 2.07: d5yxkd1, d5yxkd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yxkA (A:)
    smlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskym
    grtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yxkA (A:)
    mlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymg
    rtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yxkB (B:)
    smlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskym
    grtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yxkB (B:)
    mlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymg
    rtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yxkC (C:)
    smlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskym
    grtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yxkC (C:)
    mlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymg
    rtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yxkD (D:)
    smlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskym
    grtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yxkD (D:)
    mlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymg
    rtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla