PDB entry 5yx1

View 5yx1 on RCSB PDB site
Description: Crystal structure of hematopoietic prostaglandin D synthase in complex with U004
Class: transferase/transferase inhibitor
Keywords: PROSTAGLANDIN, SYNTHASE, Inhibitor, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-12-01, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yx1a1, d5yx1a2
  • Chain 'B':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yx1b1, d5yx1b2
  • Chain 'C':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yx1c1, d5yx1c2
  • Chain 'D':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yx1d1, d5yx1d2
  • Heterogens: MG, GSH, UX4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yx1A (A:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yx1B (B:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yx1C (C:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yx1D (D:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl