PDB entry 5ywx

View 5ywx on RCSB PDB site
Description: Crystal structure of hematopoietic prostaglandin D synthase in complex with F092
Class: transferase/transferase inhibitor
Keywords: PROSTAGLANDIN, SYNTHASE, Inhibitor, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-11-30, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ywxa1, d5ywxa2
  • Chain 'B':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ywxb1, d5ywxb2
  • Chain 'C':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ywxc1, d5ywxc2
  • Chain 'D':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ywxd1, d5ywxd2
  • Heterogens: GSH, 93C, GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ywxA (A:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ywxB (B:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ywxC (C:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ywxD (D:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl