PDB entry 5yw3

View 5yw3 on RCSB PDB site
Description: X-ray Crystal Structure of Pseudoazurin Thr36Lys Variant
Class: electron transport
Keywords: electron trnasport, electron transport
Deposited on 2017-11-28, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: BCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19567 (0-123)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d5yw3a_
  • Chain 'B':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: BCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19567 (0-123)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d5yw3b_
  • Chain 'C':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: BCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19567 (0-123)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d5yw3c_
  • Chain 'D':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: BCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19567 (0-123)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d5yw3d_
  • Heterogens: CU, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yw3A (A:)
    adfevhmlnkgkdgamvfepaslkvapgdtvtfipkdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yw3B (B:)
    adfevhmlnkgkdgamvfepaslkvapgdtvtfipkdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yw3C (C:)
    adfevhmlnkgkdgamvfepaslkvapgdtvtfipkdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yw3D (D:)
    adfevhmlnkgkdgamvfepaslkvapgdtvtfipkdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn