PDB entry 5yw1

View 5yw1 on RCSB PDB site
Description: Crystal structure of full length NS3 protein (eD4NS2BNS3) in complex with Bovine Pancreatic Trypsin Inhibitor
Class: viral protein
Keywords: serine protease, non-structural protein 3, deah helicase, ATPase, dengue virus, flavivirus, viral protein
Deposited on 2017-11-28, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavivirus_ns2b
    Species: DENGUE VIRUS 4 [TaxId:11070]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Peptidase S7
    Species: DENGUE VIRUS 4 [TaxId:11070]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: PTI protein
    Species: Bos taurus [TaxId:9913]
    Gene: PTI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yw1i_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yw1I (I:)
    rpdfcleppytgpckarmiryfynakaglcqpfvyggcrakrnnfkssedcmrtc