PDB entry 5yun

View 5yun on RCSB PDB site
Description: Crystal structure of SSB complexed with myc
Class: DNA binding protein
Keywords: Single-strand DNA binding protein, DNA BINDING PROTEIN
Deposited on 2017-11-22, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-stranded DNA-binding protein
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: ssb, PA4232
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yuna1, d5yuna2
  • Chain 'B':
    Compound: Single-stranded DNA-binding protein
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: ssb, PA4232
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yunb1, d5yunb2
  • Chain 'C':
    Compound: Single-stranded DNA-binding protein
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: ssb, PA4232
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yunc1, d5yunc2
  • Chain 'D':
    Compound: Single-stranded DNA-binding protein
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: ssb, PA4232
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yund_
  • Heterogens: MYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yunA (A:)
    margvnkvilvgnvggdpetrympngnavtnitlatseswkdkqtgqqqertewhrvvff
    grlaeiageylrkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllggrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yunA (A:)
    gvnkvilvgnvggdpetrympngnavtnitlatseswqqertewhrvvffgrlaeiagey
    lrkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yunB (B:)
    margvnkvilvgnvggdpetrympngnavtnitlatseswkdkqtgqqqertewhrvvff
    grlaeiageylrkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllggrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yunB (B:)
    gvnkvilvgnvggdpetrympngnavtnitlatseswqertewhrvvffgrlaeiageyl
    rkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yunC (C:)
    margvnkvilvgnvggdpetrympngnavtnitlatseswkdkqtgqqqertewhrvvff
    grlaeiageylrkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllggrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yunC (C:)
    rgvnkvilvgnvggdpetrympngnavtnitlatseswertewhrvvffgrlaeiageyl
    rkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yunD (D:)
    margvnkvilvgnvggdpetrympngnavtnitlatseswkdkqtgqqqertewhrvvff
    grlaeiageylrkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllggrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yunD (D:)
    argvnkvilvgnvggdpetrympngnavtnitlatseswertewhrvvffgrlaeiagey
    lrkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqll