PDB entry 5yu2

View 5yu2 on RCSB PDB site
Description: Structure of Ribonuclease YabJ
Class: gene regulation
Keywords: SAV0497, YabJ, ribonuclease, GENE REGULATION
Deposited on 2017-11-20, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation inhibitor homologue
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: SAV0497
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yu2a1, d5yu2a2
  • Chain 'B':
    Compound: Translation initiation inhibitor homologue
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: SAV0497
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yu2b_
  • Chain 'C':
    Compound: Translation initiation inhibitor homologue
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: SAV0497
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yu2c_
  • Chain 'D':
    Compound: Translation initiation inhibitor homologue
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: SAV0497
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yu2d_
  • Chain 'E':
    Compound: Translation initiation inhibitor homologue
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: SAV0497
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yu2e_
  • Chain 'F':
    Compound: Translation initiation inhibitor homologue
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: SAV0497
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yu2f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yu2A (A:)
    gaasmkiinttrlpealgpyshatvvngmvytsgqiplnvdgkivsadvqaqtkqvlenl
    kvvleeagsdlnsvakatifikdmndfqkinevygqyfnehkparscvevarlpkdvkve
    ielvskikel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yu2A (A:)
    gaasmkiinttrlpealgpyshatvvngmvytsgqiplnvdgkivsadvqaqtkqvlenl
    kvvleeagsdlnsvakatifikdmndfqkinevygqyfnehkparscvevarlpkdvkve
    ielvskik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yu2B (B:)
    gaasmkiinttrlpealgpyshatvvngmvytsgqiplnvdgkivsadvqaqtkqvlenl
    kvvleeagsdlnsvakatifikdmndfqkinevygqyfnehkparscvevarlpkdvkve
    ielvskikel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yu2B (B:)
    mkiinttrlpealgpyshatvvngmvytsgqiplnvdgkivsadvqaqtkqvlenlkvvl
    eeagsdlnsvakatifikdmndfqkinevygqyfnehkparscvevarlpkdvkveielv
    skik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yu2C (C:)
    gaasmkiinttrlpealgpyshatvvngmvytsgqiplnvdgkivsadvqaqtkqvlenl
    kvvleeagsdlnsvakatifikdmndfqkinevygqyfnehkparscvevarlpkdvkve
    ielvskikel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yu2C (C:)
    mkiinttrlpealgpyshatvvngmvytsgqiplnvdgkivsadvqaqtkqvlenlkvvl
    eeagsdlnsvakatifikdmndfqkinevygqyfnehkparscvevarlpkdvkveielv
    skikel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yu2D (D:)
    gaasmkiinttrlpealgpyshatvvngmvytsgqiplnvdgkivsadvqaqtkqvlenl
    kvvleeagsdlnsvakatifikdmndfqkinevygqyfnehkparscvevarlpkdvkve
    ielvskikel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yu2D (D:)
    mkiinttrlpealgpyshatvvngmvytsgqiplnvdgkivsadvqaqtkqvlenlkvvl
    eeagsdlnsvakatifikdmndfqkinevygqyfnehkparscvevarlpkdvkveielv
    skik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5yu2E (E:)
    gaasmkiinttrlpealgpyshatvvngmvytsgqiplnvdgkivsadvqaqtkqvlenl
    kvvleeagsdlnsvakatifikdmndfqkinevygqyfnehkparscvevarlpkdvkve
    ielvskikel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yu2E (E:)
    mkiinttrlpealgpyshatvvngmvytsgqiplnvdgkivsadvqaqtkqvlenlkvvl
    eeagsdlnsvakatifikdmndfqkinevygqyfnehkparscvevarlpkdvkveielv
    skik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5yu2F (F:)
    gaasmkiinttrlpealgpyshatvvngmvytsgqiplnvdgkivsadvqaqtkqvlenl
    kvvleeagsdlnsvakatifikdmndfqkinevygqyfnehkparscvevarlpkdvkve
    ielvskikel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yu2F (F:)
    mkiinttrlpealgpyshatvvngmvytsgqiplnvdgkivsadvqaqtkqvlenlkvvl
    eeagsdlnsvakatifikdmndfqkinevygqyfnehkparscvevarlpkdvkveielv
    skik