PDB entry 5yta

View 5yta on RCSB PDB site
Description: Pig Heart Lactate Dehydrogenase in complex with NADH and Oxamate
Class: oxidoreductase
Keywords: lactate dehydrogenase, NADH, oxamate, OXIDOREDUCTASE
Deposited on 2017-11-17, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase B chain
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ytaa1, d5ytaa2
  • Chain 'B':
    Compound: L-lactate dehydrogenase B chain
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ytab1, d5ytab2
  • Heterogens: NAD, OXM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ytaA (A:)
    atlkekliapvaeeettipnnkitvvgvgqvgmacaisilgksltdelalvdvledklkg
    emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
    ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgv
    hpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesaye
    viklkgytnwaiglsvadliesmlknlsrihpvstmvqgmygienevflslpcvlnargl
    tsvinqklkddevaqlknsadtlwgiqkdlkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ytaB (B:)
    atlkekliapvaeeettipnnkitvvgvgqvgmacaisilgksltdelalvdvledklkg
    emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
    ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgv
    hpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesaye
    viklkgytnwaiglsvadliesmlknlsrihpvstmvqgmygienevflslpcvlnargl
    tsvinqklkddevaqlknsadtlwgiqkdlkd