PDB entry 5yt8

View 5yt8 on RCSB PDB site
Description: Crystal structure of H5 hemagglutinin with G228S Q226L mutants from A/chicken/Taiwan/0502/2012
Class: viral protein
Keywords: influenza virus, H5N2, VIRAL PROTEIN
Deposited on 2017-11-17, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/Taiwan/0502/2012(H5N2)) [TaxId:1490024]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 5YT8
    Domains in SCOPe 2.07: d5yt8a1, d5yt8a2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yt8A (A:)
    mllvnqshqgfnkehtskmvsaivlyvllaaaahsafasagdricigyhannsttqvdti
    meknvtvthaqdilekehngrlcslkgvkplilkncsvagwllgnpmcdeflnapewsyi
    vekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifprsswsnhdassgvssacpyng
    rssffrnvvwlikknnvyrtitrtynntniedlliiwgihhpnnaaeqiklyqnpstyvs
    vgtstlnqrsipeiatrpkvnglssrmeffwtilrpndsitfestgnfiapeyaykivkk
    gdsaimkselsysncdtkcqtpvgainssmpfhnvhpfaigecpkyvklkklvlatglrn
    ipqretrglfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvn
    siiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhds
    nvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreei
    dsglvprgspgsgyipeaprdgqayvrkdgewvllstflghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yt8A (A:)
    gdricigyhannsttqvdtimeknvtvthaqdilekehngrlcslkgvkplilkncsvag
    wllgnpmcdeflnapewsyivekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifpr
    sswsnhdassgvssacpyngrssffrnvvwlikknnvyrtitrtynntniedlliiwgih
    hpnnaaeqiklyqnpstyvsvgtstlnqrsipeiatrpkvnglssrmeffwtilrpndsi
    tfestgnfiapeyaykivkkgdsaimkselsysncdtkcqtpvgainssmpfhnvhpfai
    gecpkyvklkklvlatglrnigaiagfieggwqgmvdgwygyhhsneqgsgyaadkestq
    kavdgitnkvnsiiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellvlm
    enertldlhdsnvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydypqy
    seesrlkreeidsgl