PDB entry 5yt3

View 5yt3 on RCSB PDB site
Description: Structure of the Human Mitogen-Activated Protein Kinase Kinase 1 S218D and S222D mutant
Class: transferase
Keywords: Kinase, TRANSFERASE
Deposited on 2017-11-16, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase kinase 1, isoform CRA_d
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP2K1, hCG_24510
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yt3a_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase kinase 1, isoform CRA_d
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP2K1, hCG_24510
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02750 (Start-343)
      • engineered mutation (179)
      • engineered mutation (183)
    Domains in SCOPe 2.07: d5yt3b_
  • Chain 'C':
    Compound: Mitogen-activated protein kinase kinase 1, isoform CRA_d
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP2K1, hCG_24510
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yt3c_
  • Chain 'D':
    Compound: Mitogen-activated protein kinase kinase 1, isoform CRA_d
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP2K1, hCG_24510
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02750 (0-343)
      • engineered mutation (179)
      • engineered mutation (183)
    Domains in SCOPe 2.07: d5yt3d_
  • Heterogens: ANP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yt3A (A:)
    eleldeqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarkl
    ihleikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkka
    gripeqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidd
    mandfvgtrsymsperlqgthysvqsdiwsmglslvemavgrypipppdakelelmfgcq
    vegdaaetpprprapgrplasygmdsrppmaifelldyivnepppklpsgvfslefqdfv
    nkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstiglnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yt3A (A:)
    eleldeqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarkl
    ihleikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkka
    gripeqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvtrsymsp
    erlqysvqsdiwsmglslvemavgrypipppdakelelmfgpmaifelldyivnepppkl
    psgvfslefqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstigln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yt3B (B:)
    eleldeqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarkl
    ihleikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkka
    gripeqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidd
    mandfvgtrsymsperlqgthysvqsdiwsmglslvemavgrypipppdakelelmfgcq
    vegdaaetpprprapgrplasygmdsrppmaifelldyivnepppklpsgvfslefqdfv
    nkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstiglnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yt3B (B:)
    leldeqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarkli
    hleikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkkag
    ripeqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqliddm
    andfvgtrsymsperlqgthysvqsdiwsmglslvemavgrypipppdakelelmfgaif
    elldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhafikrsdaeevdf
    agwlcstigln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yt3C (C:)
    eleldeqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarkl
    ihleikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkka
    gripeqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidd
    mandfvgtrsymsperlqgthysvqsdiwsmglslvemavgrypipppdakelelmfgcq
    vegdaaetpprprapgrplasygmdsrppmaifelldyivnepppklpsgvfslefqdfv
    nkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstiglnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yt3C (C:)
    leldeqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarkli
    hairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkkagripeq
    ilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgsymsperlysvqsd
    iwsmglslvemavgrypipppdakelelmfgcpmaifelldyivnepppklpsgvfslef
    qdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstigln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yt3D (D:)
    eleldeqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarkl
    ihleikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkka
    gripeqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidd
    mandfvgtrsymsperlqgthysvqsdiwsmglslvemavgrypipppdakelelmfgcq
    vegdaaetpprprapgrplasygmdsrppmaifelldyivnepppklpsgvfslefqdfv
    nkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstiglnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yt3D (D:)
    eleldeqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarkl
    ihlkpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkkagr
    ipeqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqliddma
    ndfvgtrsymsperlqgthysvqsdiwsmglslvemavgrypipppdakelelmfaifel
    ldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfag
    wlcstigln