PDB entry 5yso

View 5yso on RCSB PDB site
Description: Crystal structure of Estrogen Related Receptor-3 (ERR-gamma) ligand binding domain with DN200434
Class: transcription
Keywords: Sodium iodide symporter (NIS), Anaplastic thyroid cancer, Estrogen-related receptor gamma, Radioiodine therapy, TRANSCRIPTION
Deposited on 2017-11-14, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG, ERR3, ERRG2, KIAA0832, NR3B3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ysoa_
  • Chain 'B':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG, ERR3, ERRG2, KIAA0832, NR3B3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ysob_
  • Chain 'C':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG, ERR3, ERRG2, KIAA0832, NR3B3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ysoc_
  • Heterogens: 90C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ysoA (A:)
    mlnpqlvqpakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvvii
    gwakhipgfstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqskla
    glldlnnailqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealq
    dyeagqhmedprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ysoA (A:)
    ynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstls
    ladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlv
    kkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprr
    agkmlmtlpllrqtstkavqhfyniklegkvpmhklflemle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ysoB (B:)
    mlnpqlvqpakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvvii
    gwakhipgfstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqskla
    glldlnnailqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealq
    dyeagqhmedprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ysoB (B:)
    pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
    sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
    vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
    ragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemlea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ysoC (C:)
    mlnpqlvqpakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvvii
    gwakhipgfstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqskla
    glldlnnailqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealq
    dyeagqhmedprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ysoC (C:)
    nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
    adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
    kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
    gkmlmtlpllrqtstkavqhfyni