PDB entry 5ysc

View 5ysc on RCSB PDB site
Description: Crystal Structure of periplasmic Vitamin B12 binding protein BtuF of Vibrio cholerae
Class: transport protein
Keywords: Vitamin B12, ABC trasporter, periplasmic protein, Vibrio cholerae, TRANSPORT PROTEIN
Deposited on 2017-11-13, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin B12-binding protein
    Species: Vibrio cholerae O395 [TaxId:345073]
    Gene: btuf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ysca_
  • Heterogens: CNC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yscA (A:)
    hhhhhhssglvprgskpfpaeriislaphateiayaaglgdklvavseysdyppqalele
    rvanhqtiniekiltlkpdliiawpagnpprelaklrqlgftiydsqtktldeiadniea
    lshysanpevgqkaahdfrqrlqdlrtqyasnqpiryfyqlsekpiitlaqghwpsevfs
    lcggvnifadsevpypqvsieqvlvkqpqviftsehaianghmwrawqaelsavqndqvw
    alnadwlnrptprtldaveqvctylkiaqkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yscA (A:)
    pfpaeriislaphateiayaaglgdklvavseysdyppqalelervanhqtiniekiltl
    kpdliiawpagnpprelaklrqlgftiydsqtktldeiadniealshysanpevgqkaah
    dfrqrlqdlrtqyasnqpiryfyqlsekpiitlaqghwpsevfslcggvnifadsevpyp
    qvsieqvlvkqpqviftsehaianghmwrawqaelsavqndqvwalnadwlnrptprtld
    aveqvctylkiaqkq