PDB entry 5yqg

View 5yqg on RCSB PDB site
Description: The structure of 14-3-3 and pNumb peptide
Class: peptide binding protein
Keywords: Complex, Phosphorylation, non-canonical, PEPTIDE BINDING PROTEIN
Deposited on 2017-11-06, released 2018-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein eta
    Species: Mus musculus [TaxId:10090]
    Gene: Ywhah
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68510 (6-End)
      • expression tag (5)
    Domains in SCOPe 2.07: d5yqga1, d5yqga2
  • Chain 'B':
    Compound: 14-3-3 protein eta
    Species: Mus musculus [TaxId:10090]
    Gene: Ywhah
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yqgb_
  • Chain 'C':
    Compound: 14-3-3 protein eta
    Species: Mus musculus [TaxId:10090]
    Gene: Ywhah
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68510 (6-End)
      • expression tag (5)
    Domains in SCOPe 2.07: d5yqgc1, d5yqgc2
  • Chain 'D':
    Compound: 14-3-3 protein eta
    Species: Mus musculus [TaxId:10090]
    Gene: Ywhah
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yqgd_
  • Chain 'E':
    Compound: Peptide from Protein numb homolog
    Species: Mus musculus [TaxId:10090]
    Gene: NUMB
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Peptide from Protein numb homolog
    Species: Mus musculus [TaxId:10090]
    Gene: NUMB
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yqgA (A:)
    gpgsefmgdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvg
    arrsswrvissieqktmadgnekklekvkayrekiekeletvcndvlalldkflikncnd
    fqyeskvfylkmkgdyyrylaevasgekknsvveaseaaykeafeiskehmqpthpirlg
    lalnfsvfyyeiqnapeqacllakqafddaiaeldtlnedsykdstlimqllrdnltlwt
    sdqqdeeagegn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqgA (A:)
    fmgdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvgarrss
    wrvissieqktmnekklekvkayrekiekeletvcndvlalldkflikncndfqyeskvf
    ylkmkgdyyrylaevasgekknsvveaseaaykeafeiskehmqpthpirlglalnfsvf
    yyeiqnapeqacllakqafddaiaelykdstlimqllrdnltlwt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yqgB (B:)
    gpgsefmgdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvg
    arrsswrvissieqktmadgnekklekvkayrekiekeletvcndvlalldkflikncnd
    fqyeskvfylkmkgdyyrylaevasgekknsvveaseaaykeafeiskehmqpthpirlg
    lalnfsvfyyeiqnapeqacllakqafddaiaeldtlnedsykdstlimqllrdnltlwt
    sdqqdeeagegn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqgB (B:)
    mgdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvgarrssw
    rvissieqktmadgnekklekvkayrekiekeletvcndvlalldkflikncndfqyesk
    vfylkmkgdyyrylaevasgekknsvveaseaaykeafeiskehmqpthpirlglalnfs
    vfyyeiqnapeqacllakqafddaiaeldtlnedsykdstlimqllrdnltlwtsd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yqgC (C:)
    gpgsefmgdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvg
    arrsswrvissieqktmadgnekklekvkayrekiekeletvcndvlalldkflikncnd
    fqyeskvfylkmkgdyyrylaevasgekknsvveaseaaykeafeiskehmqpthpirlg
    lalnfsvfyyeiqnapeqacllakqafddaiaeldtlnedsykdstlimqllrdnltlwt
    sdqqdeeagegn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqgC (C:)
    fmgdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvgarrss
    wrvissieqktmadgnekklekvkayrekiekeletvcndvlalldkflikncndfqyes
    kvfylkmkgdyyrylaevasgekknsvveaseaaykeafeiskehmqpthpirlglalnf
    svfyyeiqnapeqacllakqafddaiaeldtlnedsykdstlimqllrdnltlwtsd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yqgD (D:)
    gpgsefmgdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvg
    arrsswrvissieqktmadgnekklekvkayrekiekeletvcndvlalldkflikncnd
    fqyeskvfylkmkgdyyrylaevasgekknsvveaseaaykeafeiskehmqpthpirlg
    lalnfsvfyyeiqnapeqacllakqafddaiaeldtlnedsykdstlimqllrdnltlwt
    sdqqdeeagegn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yqgD (D:)
    mgdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvgarrssw
    rvissieqktmanekklekvkayrekiekeletvcndvlalldkflikncndfqyeskvf
    ylkmkgdyyrylaevasgekknsvveaseaaykeafeiskehmqpthpirlglalnfsvf
    yyeiqnapeqacllakqafddaiaeldsykdstlimqllrdnltlwt
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.