PDB entry 5ypn

View 5ypn on RCSB PDB site
Description: Crystal structure of NDM-1 bound to hydrolyzed meropenem representing an EI2 complex
Class: hydrolase
Keywords: MDM-1, meropenem, EI2 complex, HYDROLASE
Deposited on 2017-11-02, released 2018-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase NDM-1
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypna_
  • Chain 'B':
    Compound: Metallo-beta-lactamase NDM-1
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypnb_
  • Heterogens: ZN, LMP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ypnA (A:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypnA (A:)
    dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
    nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
    faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
    dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ypnB (B:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypnB (B:)
    dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
    nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
    faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
    dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr