PDB entry 5ypi

View 5ypi on RCSB PDB site
Description: Crystal structure of NDM-1 bound to hydrolyzed imipenem representing an EI1 complex
Class: hydrolase
Keywords: NDM-1, Imipenem, EI1 complex, HYDROLASE
Deposited on 2017-11-01, released 2018-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase NDM-1
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypia_
  • Chain 'B':
    Compound: Metallo-beta-lactamase NDM-1
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypib_
  • Chain 'C':
    Compound: Metallo-beta-lactamase NDM-1
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypic_
  • Chain 'D':
    Compound: Metallo-beta-lactamase NDM-1
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypid_
  • Chain 'E':
    Compound: Metallo-beta-lactamase NDM-1
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypie_
  • Chain 'F':
    Compound: Metallo-beta-lactamase NDM-1
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypif_
  • Chain 'G':
    Compound: Metallo-beta-lactamase NDM-1
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypig_
  • Chain 'H':
    Compound: Metallo-beta-lactamase NDM-1
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ypih_
  • Heterogens: 8YF, ZN, SO4, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ypiA (A:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypiA (A:)
    dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
    nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
    faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
    dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ypiB (B:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypiB (B:)
    dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
    nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
    faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
    dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ypiC (C:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypiC (C:)
    dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
    nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
    faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
    dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ypiD (D:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypiD (D:)
    dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
    nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
    faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
    dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ypiE (E:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypiE (E:)
    dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
    nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
    faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
    dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ypiF (F:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypiF (F:)
    dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
    nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
    faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
    dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ypiG (G:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypiG (G:)
    dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
    nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
    faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
    dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ypiH (H:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ypiH (H:)
    dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
    nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
    faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
    dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr