PDB entry 5yno

View 5yno on RCSB PDB site
Description: Crystal structure of MERS-CoV nsp16/nsp10 complex bound to SAH and m7GpppA
Class: transferase
Keywords: inhibitor, complex, TRANSFERASE
Deposited on 2017-10-24, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nsp16 protein
    Species: Human betacoronavirus 2c EMC/2012 [TaxId:1235996]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: nsp10 protein
    Species: Human betacoronavirus 2c EMC/2012 [TaxId:1235996]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ynob_
  • Heterogens: SAH, GTA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ynoB (B:)
    agsntefasnssvlslvnftvdpqkayldfvnaggapltncvkmltpktgtgiaisvkpe
    stadqetyggasvclycrahiehpdvsgvckykgkfvqipaqcvrdpvgfclsntpcnvc
    qywigygcncdslrqaalpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ynoB (B:)
    nssvlslvnftvdpqkayldfvnaggapltncvkmltpktgtgiaisvkpestadqetyg
    gasvclycrahiehpdvsgvckykgkfvqipaqcvrdpvgfclsntpcnvcqywigygcn
    c