PDB entry 5ync

View 5ync on RCSB PDB site
Description: Crystal structure of Pullulanase from Klebsiella pneumoniae complex at 1 mM beta-cyclodextrin
Class: hydrolase
Keywords: HYDROLASE, alpha-amylase, pullulanase, Klebsiella pneumoniae, crystal, beta-cyclodextrin, co-crystallization
Deposited on 2017-10-24, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PulA protein
    Species: Klebsiella pneumoniae [TaxId:573]
    Database cross-references and differences (RAF-indexed):
    • Uniprot W9BQ28 (Start-1101)
      • conflict (698)
    Domains in SCOPe 2.07: d5ynca1, d5ynca2, d5ynca3, d5ynca4, d5ynca5
  • Heterogens: CA, ACT, GLC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yncA (A:)
    mlrytchalflgslvllsgcdnssssstsgspgspgnpgnpgtpgtpdpqdvvvrlpdva
    vpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdalsapvadwndvstt
    ptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftdrtvsviagnsavy
    dsradafraafgvaladahwvdkttllwpggenkpivrlyyshsskvaadsngefsdkyv
    kltpttvnqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgilssatqvqta
    gvlddtyaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsas
    gawswqggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsal
    kpegwdgltmphaqktkadlakmtiheshirdlsawdqtvpaelrgkylaltaqesnmvq
    hlkqlsasgvthiellpvfdlatvnefsdkvadiqqpfsrlcevnsavkssefagycdsg
    stveevltqlkqndskdnpqvqalntlvaqtdsynwgydpfhytvpegsyatdpegtari
    kefrtmiqaikqdlgmnvimdvvynhtnaagptdrtsvldkivpwyyqrlnettgsvesa
    tccsdsapehrmfakliadslavwttdykidgfrfdlmlyhpkaqilsawerikalnpdi
    yffgegwdsnqsdrfeiasqinlkgtgigtfsdrlrdavrgggpfdsgdalrqnqgvgsg
    agvlpnelttlsddqarhladltrlgmagnladfvlidkdgavkrgseidyngapggyaa
    dptevvnyvskhdnqtlwdmisykaaqeadldtrvrmqavslatvmlgqgiafdqqgsel
    lrsksftrdsydsgdwfnrvdyslqdnnynvgmprssddgsnydiiarvkdavatpgete
    lkqmtafyqeltalrkssplftlgdgatvmkrvdfrntgadqqtgllvmtiddgmqagas
    ldsrvdgivvainaapesrtlqdfagtslqlsaiqqaagdrslasgvqvaadgsvtlpaw
    svavlelpqgesqgaglpvssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yncA (A:)
    dvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdalsap
    vadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftdrtv
    sviagnsavydsradafraafgvaladahwvdkttllwpggenkpivrlyyshsskvaad
    sngefsdkyvkltpttvnqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgi
    lssatqvqtagvlddtyaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkvia
    shpmtrdsasgawswqggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseys
    qvvdlndsalkpegwdgltmphaqktkadlakmtiheshirdlsawdqtvpaelrgkyla
    ltaqesnmvqhlkqlsasgvthiellpvfdlatvnefsdkvadiqqpfsrlcevnsavks
    sefagycdsgstveevltqlkqndskdnpqvqalntlvaqtdsynwgydpfhytvpegsy
    atdpegtarikefrtmiqaikqdlgmnvimdvvynhtnaagptdrtsvldkivpwyyqrl
    nettgsvesatccsdsapehrmfakliadslavwttdykidgfrfdlmlyhpkaqilsaw
    erikalnpdiyffgegwdsnqsdrfeiasqinlkgtgigtfsdrlrdavrgggpfdsgda
    lrqnqgvgsgagvlpnelttlsddqarhladltrlgmagnladfvlidkdgavkrgseid
    yngapggyaadptevvnyvskhdnqtlwdmisykaaqeadldtrvrmqavslatvmlgqg
    iafdqqgsellrsksftrdsydsgdwfnrvdyslqdnnynvgmprssddgsnydiiarvk
    davatpgetelkqmtafyqeltalrkssplftlgdgatvmkrvdfrntgadqqtgllvmt
    iddgmqagasldsrvdgivvainaapesrtlqdfagtslqlsaiqqaagdrslasgvqva
    adgsvtlpawsvavlelpqgesqgaglpvssk