PDB entry 5yn3

View 5yn3 on RCSB PDB site
Description: Crystal strcuture of xylose isomerase from Piromyces sp. E2
Class: isomerase
Keywords: Xylose isomerase, ISOMERASE
Deposited on 2017-10-24, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Piromyces sp. (strain E2) [TaxId:73868]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yn3a_
  • Chain 'B':
    Compound: xylose isomerase
    Species: Piromyces sp. (strain E2) [TaxId:73868]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yn3b_
  • Chain 'C':
    Compound: xylose isomerase
    Species: Piromyces sp. (strain E2) [TaxId:73868]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yn3c_
  • Chain 'D':
    Compound: xylose isomerase
    Species: Piromyces sp. (strain E2) [TaxId:73868]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yn3d_
  • Heterogens: MN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yn3A (A:)
    mrgshhhhhhgsmakeyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfama
    wwhtlcaegadqfgggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvs
    egnsieeyesnlkavvaylkekqketgikllwstanvfghkrymngastnpdfdvvarai
    vqiknaidagielgaenyvfwggregymsllntdqkrekehmatmltmardyarskgfkg
    tfliepkpmeptkhqydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacav
    dagmlgsidanrgdyqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnst
    dlediiiahvsgmdamaralenaakllqespytkmkkeryasfdsgigkdfedgkltleq
    vyeygkkngepkqtsgkqelyeaivamyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yn3A (A:)
    keyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadqfg
    ggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnlka
    vvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagielg
    aenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmeptkh
    qydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanrgd
    yqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsgmd
    amaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepkqt
    sgkqelyeaivamyq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yn3B (B:)
    mrgshhhhhhgsmakeyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfama
    wwhtlcaegadqfgggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvs
    egnsieeyesnlkavvaylkekqketgikllwstanvfghkrymngastnpdfdvvarai
    vqiknaidagielgaenyvfwggregymsllntdqkrekehmatmltmardyarskgfkg
    tfliepkpmeptkhqydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacav
    dagmlgsidanrgdyqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnst
    dlediiiahvsgmdamaralenaakllqespytkmkkeryasfdsgigkdfedgkltleq
    vyeygkkngepkqtsgkqelyeaivamyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yn3B (B:)
    keyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadqfg
    ggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnlka
    vvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagielg
    aenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmeptkh
    qydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanrgd
    yqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsgmd
    amaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepkqt
    sgkqelyeaivamyq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yn3C (C:)
    mrgshhhhhhgsmakeyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfama
    wwhtlcaegadqfgggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvs
    egnsieeyesnlkavvaylkekqketgikllwstanvfghkrymngastnpdfdvvarai
    vqiknaidagielgaenyvfwggregymsllntdqkrekehmatmltmardyarskgfkg
    tfliepkpmeptkhqydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacav
    dagmlgsidanrgdyqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnst
    dlediiiahvsgmdamaralenaakllqespytkmkkeryasfdsgigkdfedgkltleq
    vyeygkkngepkqtsgkqelyeaivamyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yn3C (C:)
    keyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadqfg
    ggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnlka
    vvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagielg
    aenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmeptkh
    qydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanrgd
    yqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsgmd
    amaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepkqt
    sgkqelyeaivamyq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yn3D (D:)
    mrgshhhhhhgsmakeyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfama
    wwhtlcaegadqfgggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvs
    egnsieeyesnlkavvaylkekqketgikllwstanvfghkrymngastnpdfdvvarai
    vqiknaidagielgaenyvfwggregymsllntdqkrekehmatmltmardyarskgfkg
    tfliepkpmeptkhqydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacav
    dagmlgsidanrgdyqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnst
    dlediiiahvsgmdamaralenaakllqespytkmkkeryasfdsgigkdfedgkltleq
    vyeygkkngepkqtsgkqelyeaivamyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yn3D (D:)
    keyfpqiqkikfegkdsknplafhyydaekevmgkkmkdwlrfamawwhtlcaegadqfg
    ggtksfpwnegtdaieiakqkvdagfeimqklgipyycfhdvdlvsegnsieeyesnlka
    vvaylkekqketgikllwstanvfghkrymngastnpdfdvvaraivqiknaidagielg
    aenyvfwggregymsllntdqkrekehmatmltmardyarskgfkgtfliepkpmeptkh
    qydvdtetaigflkahnldkdfkvnievnhatlaghtfehelacavdagmlgsidanrgd
    yqngwdtdqfpidqyelvqawmeiirgggfvtggtnfdaktrrnstdlediiiahvsgmd
    amaralenaakllqespytkmkkeryasfdsgigkdfedgkltleqvyeygkkngepkqt
    sgkqelyeaivamyq