PDB entry 5ym7

View 5ym7 on RCSB PDB site
Description: Crystal Structure of B562RIL without disulfide bond
Class: electron transport
Keywords: hemoprotein, fusion partner, helix bundle, ELECTRON TRANSPORT
Deposited on 2017-10-21, released 2017-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (6)
      • engineered mutation (101)
      • engineered mutation (105)
    Domains in SCOPe 2.08: d5ym7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ym7A (A:)
    adlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl