PDB entry 5yl8

View 5yl8 on RCSB PDB site
Description: The crystal structure of inactive dimeric peptidyl-tRNA hydrolase from Acinetobacter baumannii at 1.79 A resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 2017-10-17, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-tRNA hydrolase
  Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
  Gene: pth, F911_03144, HMPREF0010_01329
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0C9L6 (0-192)
  Domains in SCOPe 2.07: d5yl8a_
• Chain 'B':
  Compound: Peptidyl-tRNA hydrolase
  Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
  Gene: pth, F911_03144, HMPREF0010_01329
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0C9L6 (0-192)
  Domains in SCOPe 2.07: d5yl8b_
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5yl8A (A:)
  msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
  rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
  ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
  pqamnqinaykpa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5yl8B (B:)
  msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
  rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
  ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
  pqamnqinaykpa