PDB entry 5ykc

View 5ykc on RCSB PDB site
Description: crystal structure of H5 hemagglutinin from A/chicken/Taiwan/0502/2012
Class: viral protein
Keywords: influenza virus, H5N2, VIRAL PROTEIN
Deposited on 2017-10-13, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/Taiwan/0502/2012(H5N2)) [TaxId:1490024]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YKC
    Domains in SCOPe 2.07: d5ykca1, d5ykca2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/Taiwan/0502/2012(H5N2)) [TaxId:1490024]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YKC
    Domains in SCOPe 2.07: d5ykcb1, d5ykcb2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/Taiwan/0502/2012(H5N2)) [TaxId:1490024]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YKC
    Domains in SCOPe 2.07: d5ykcc1, d5ykcc2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ykcA (A:)
    mllvnqshqgfnkehtskmvsaivlyvllaaaahsafasagdricigyhannsttqvdti
    meknvtvthaqdilekehngrlcslkgvkplilkncsvagwllgnpmcdeflnapewsyi
    vekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifprsswsnhdassgvssacpyng
    rssffrnvvwlikknnvyrtitrtynntniedlliiwgihhpnnaaeqiklyqnpstyvs
    vgtstlnqrsipeiatrpkvngqsgrmeffwtilrpndsitfestgnfiapeyaykivkk
    gdsaimkselsysncdtkcqtpvgainssmpfhnvhpfaigecpkyvklkklvlatglrn
    ipqretrglfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvn
    siiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhds
    nvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreei
    dsglvprgspgsgyipeaprdgqayvrkdgewvllstflghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ykcA (A:)
    agdricigyhannsttqvdtimeknvtvthaqdilekehngrlcslkgvkplilkncsva
    gwllgnpmcdeflnapewsyivekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifp
    rsswsnhdassgvssacpyngrssffrnvvwlikknnvyrtitrtynntniedlliiwgi
    hhpnnaaeqiklyqnpstyvsvgtstlnqrsipeiatrpkvngqsgrmeffwtilrpnds
    itfestgnfiapeyaykivkkgdsaimkselsysncdtkcqtpvgainssmpfhnvhpfa
    igecpkyvklkklvlatglrnipqaiagfieggwqgmvdgwygyhhsneqgsgyaadkes
    tqkavdgitnkvnsiiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellv
    lmenertldlhdsnvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydyp
    qyseesrlkreeidsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ykcB (B:)
    mllvnqshqgfnkehtskmvsaivlyvllaaaahsafasagdricigyhannsttqvdti
    meknvtvthaqdilekehngrlcslkgvkplilkncsvagwllgnpmcdeflnapewsyi
    vekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifprsswsnhdassgvssacpyng
    rssffrnvvwlikknnvyrtitrtynntniedlliiwgihhpnnaaeqiklyqnpstyvs
    vgtstlnqrsipeiatrpkvngqsgrmeffwtilrpndsitfestgnfiapeyaykivkk
    gdsaimkselsysncdtkcqtpvgainssmpfhnvhpfaigecpkyvklkklvlatglrn
    ipqretrglfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvn
    siiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhds
    nvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreei
    dsglvprgspgsgyipeaprdgqayvrkdgewvllstflghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ykcB (B:)
    agdricigyhannsttqvdtimeknvtvthaqdilekehngrlcslkgvkplilkncsva
    gwllgnpmcdeflnapewsyivekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifp
    rsswsnhdassgvssacpyngrssffrnvvwlikknnvyrtitrtynntniedlliiwgi
    hhpnnaaeqiklyqnpstyvsvgtstlnqrsipeiatrpkvngqsgrmeffwtilrpnds
    itfestgnfiapeyaykivkkgdsaimkselsysncdtkcqtpvgainssmpfhnvhpfa
    igecpkyvklkklvlatglrnipqriagfieggwqgmvdgwygyhhsneqgsgyaadkes
    tqkavdgitnkvnsiiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellv
    lmenertldlhdsnvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydyp
    qyseesrlkreeidsgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ykcC (C:)
    mllvnqshqgfnkehtskmvsaivlyvllaaaahsafasagdricigyhannsttqvdti
    meknvtvthaqdilekehngrlcslkgvkplilkncsvagwllgnpmcdeflnapewsyi
    vekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifprsswsnhdassgvssacpyng
    rssffrnvvwlikknnvyrtitrtynntniedlliiwgihhpnnaaeqiklyqnpstyvs
    vgtstlnqrsipeiatrpkvngqsgrmeffwtilrpndsitfestgnfiapeyaykivkk
    gdsaimkselsysncdtkcqtpvgainssmpfhnvhpfaigecpkyvklkklvlatglrn
    ipqretrglfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvn
    siiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhds
    nvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreei
    dsglvprgspgsgyipeaprdgqayvrkdgewvllstflghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ykcC (C:)
    agdricigyhannsttqvdtimeknvtvthaqdilekehngrlcslkgvkplilkncsva
    gwllgnpmcdeflnapewsyivekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifp
    rsswsnhdassgvssacpyngrssffrnvvwlikknnvyrtitrtynntniedlliiwgi
    hhpnnaaeqiklyqnpstyvsvgtstlnqrsipeiatrpkvngqsgrmeffwtilrpnds
    itfestgnfiapeyaykivkkgdsaimkselsysncdtkcqtpvgainssmpfhnvhpfa
    igecpkyvklkklvlatglrnipqiagfieggwqgmvdgwygyhhsneqgsgyaadkest
    qkavdgitnkvnsiiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellvl
    menertldlhdsnvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydypq
    yseesrlkreeidsg