PDB entry 5yja

View 5yja on RCSB PDB site
Description: Crystal structure of highly active BTUO mutant P287G without dehydration
Class: oxidoreductase
Keywords: protein engineering, enzyme, loop flexibility, entropy of activation, OXIDOREDUCTASE
Deposited on 2017-10-09, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yjaa1, d5yjaa2
  • Chain 'B':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yjab1, d5yjab2
  • Chain 'C':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yjac1, d5yjac2
  • Chain 'D':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yjad1, d5yjad2
  • Heterogens: AZA, OXY, SO4, K, MXE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yjaA (A:)
    tkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllts
    ftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeip
    fettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsg
    nsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvf
    hetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeigesegkvyteprppy
    gfqcftvtqedlphenilmfsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yjaA (A:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveegkvyteprppygfqcftvtq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yjaB (B:)
    tkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllts
    ftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeip
    fettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsg
    nsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvf
    hetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeigesegkvyteprppy
    gfqcftvtqedlphenilmfsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yjaB (B:)
    myygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdns
    lvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfav
    kngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgfi
    rdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetls
    iqhliyligrrilerfpqlqevyfesqnhtwdkiveeiegkvyteprppygfqcftvtqe
    dl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yjaC (C:)
    tkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllts
    ftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeip
    fettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsg
    nsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvf
    hetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeigesegkvyteprppy
    gfqcftvtqedlphenilmfsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yjaC (C:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkivkvyteprppygfqcftvtqedlp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yjaD (D:)
    tkhkervmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtkllts
    ftkgdnslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeip
    fettfavkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsg
    nsfvgfirdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvf
    hetetlsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeigesegkvyteprppy
    gfqcftvtqedlphenilmfsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yjaD (D:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkivekvyteprppygfqcftvtq