PDB entry 5yj2

View 5yj2 on RCSB PDB site
Description: Crystal structure of Bacillus sp. TB-90 urate oxidase without dehydration
Class: oxidoreductase
Keywords: enzyme catalysis, oxidation, water square, dehydration, humid control, environmental adaptation, OXIDOREDUCTASE
Deposited on 2017-10-07, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yj2a1, d5yj2a2
  • Chain 'B':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yj2b1, d5yj2b2
  • Chain 'C':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yj2c1, d5yj2c2
  • Chain 'D':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yj2d1, d5yj2d2
  • Heterogens: AZA, OXY, MXE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yj2A (A:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcft
    vtqedlphenil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yj2A (A:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcft
    vtq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yj2B (B:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcft
    vtqedlphenil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yj2B (B:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcft
    vtq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yj2C (C:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcft
    vtqedlphenil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yj2C (C:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcft
    vtq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yj2D (D:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcft
    vtqedlphenil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yj2D (D:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcft
    vtq