PDB entry 5yis

View 5yis on RCSB PDB site
Description: Crystal Structure of AnkB LIR/LC3B complex
Class: protein binding
Keywords: Autophagy, PROTEIN BINDING
Deposited on 2017-10-06, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated proteins 1A/1B light chain 3B
    Species: Mus musculus [TaxId:10090]
    Gene: Map1lc3b, Map1alc3, Map1lc3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yisa_
  • Chain 'B':
    Compound: Microtubule-associated proteins 1A/1B light chain 3B
    Species: Mus musculus [TaxId:10090]
    Gene: Map1lc3b, Map1alc3, Map1lc3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yisb_
  • Chain 'C':
    Compound: Ankyrin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANK2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ankyrin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANK2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yisA (A:)
    mpsektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnm
    selikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqetfg
    tamav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yisA (A:)
    ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli
    kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yisB (B:)
    mpsektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnm
    selikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqetfg
    tamav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yisB (B:)
    ektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmsel
    ikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqetfgtam
    av
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.