PDB entry 5yip

View 5yip on RCSB PDB site
Description: Crystal Structure of AnkG LIR/GABARAPL1 complex
Class: signaling protein
Keywords: Autophagy, SIGNALING PROTEIN
Deposited on 2017-10-06, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyric acid receptor-associated protein-like 1
    Species: Mus musculus [TaxId:10090]
    Gene: Gabarapl1, Apg8l, Atg8l, Gec1, MNCb-0091
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R3R8 (6-122)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d5yipa1, d5yipa2
  • Chain 'B':
    Compound: Ankyrin-3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ank3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yipA (A:)
    gpgsefmkfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdldkrkylvpsd
    ltvgqfyflirkrihlrpedalfffvnntipptsatmgqlyednheedyflyvaysdesv
    ygk
    

  • Chain 'B':
    No sequence available.