PDB entry 5yih

View 5yih on RCSB PDB site
Description: Crystal structure of tetrameric Nucleoside diphosphate kinase at 1.98 A resolution from Acinetobacter baumannii
Class: transferase
Keywords: Kinase, TRANSFERASE
Deposited on 2017-10-04, released 2017-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Acinetobacter baumannii [TaxId:575584]
    Gene: ndk, F911_03401, HMPREF0010_01731
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yiha_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Acinetobacter baumannii [TaxId:575584]
    Gene: ndk, F911_03401, HMPREF0010_01731
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yihb_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Acinetobacter baumannii [TaxId:575584]
    Gene: ndk, F911_03401, HMPREF0010_01731
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yihc_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase
    Species: Acinetobacter baumannii [TaxId:575584]
    Gene: ndk, F911_03401, HMPREF0010_01731
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yihd_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yihA (A:)
    maiertlsivkpdavsknhigeifarfekaglkivatkmkhlsqadaegfyaehkergff
    gdlvafmtsgpvvvsvlegenavlahreilgatnpkeaapgtiradfavsidenaahgsd
    svasaereiayffadneicprtr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yihB (B:)
    maiertlsivkpdavsknhigeifarfekaglkivatkmkhlsqadaegfyaehkergff
    gdlvafmtsgpvvvsvlegenavlahreilgatnpkeaapgtiradfavsidenaahgsd
    svasaereiayffadneicprtr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yihC (C:)
    maiertlsivkpdavsknhigeifarfekaglkivatkmkhlsqadaegfyaehkergff
    gdlvafmtsgpvvvsvlegenavlahreilgatnpkeaapgtiradfavsidenaahgsd
    svasaereiayffadneicprtr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yihD (D:)
    maiertlsivkpdavsknhigeifarfekaglkivatkmkhlsqadaegfyaehkergff
    gdlvafmtsgpvvvsvlegenavlahreilgatnpkeaapgtiradfavsidenaahgsd
    svasaereiayffadneicprtr