PDB entry 5yig

View 5yig on RCSB PDB site
Description: Crystal structure of Streptococcus pneumonia ParE with inhibitor
Class: antimicrobial protein
Keywords: Inhibitor, ANTIMICROBIAL PROTEIN
Deposited on 2017-10-04, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase 4 subunit B
    Species: Streptococcus pneumoniae GA47502 [TaxId:760839]
    Gene: parE, SPAR98_0871
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yiga_
  • Chain 'B':
    Compound: DNA topoisomerase 4 subunit B
    Species: Streptococcus pneumoniae GA47502 [TaxId:760839]
    Gene: parE, SPAR98_0871
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yigb_
  • Heterogens: 54B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yigA (A:)
    qvlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltv
    qdhgrgmptgmhamgiptveviftilhaggkfgqggyktsgglhgvgssvvnalsswlev
    eitrdgavykqrfenggkpvttlkkigtalksktgtkvtfmpdatifsttdfkyntiser
    lnesafllknvtlsltdkrtdeaiefhyen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yigA (A:)
    vlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltvq
    dhgrgmptgmhamgiptveviftilhavgssvvnalsswleveitrdgavykqrfenggk
    pvttlkkigtalksktgtkvtfmpdatifsttdfkyntiserlnesafllknvtlsltdk
    rtdeaiefhyen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yigB (B:)
    qvlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltv
    qdhgrgmptgmhamgiptveviftilhaggkfgqggyktsgglhgvgssvvnalsswlev
    eitrdgavykqrfenggkpvttlkkigtalksktgtkvtfmpdatifsttdfkyntiser
    lnesafllknvtlsltdkrtdeaiefhyen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yigB (B:)
    qvlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltv
    qdhgrgmptgmhamgiptveviftilhagvgssvvnalsswleveitrdgavykqrfeng
    gkpvttlkkigtalksktgtkvtfmpdatifsttdfkyntiserlnesafllknvtlslt
    dkrtdeaiefhyen