PDB entry 5yif

View 5yif on RCSB PDB site
Description: Pyruvylated beta-D-galactosidase from Bacillus sp. HMA207, E163A mutant pyruvylated beta-D-galactose complex
Class: hydrolase
Keywords: glycoside hydrolase, hydrolase
Deposited on 2017-10-04, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvylated beta-D-galactosidase
    Species: Bacillus sp. [TaxId:1409]
    Gene: ORF1119
    Database cross-references and differences (RAF-indexed):
    • PDB 5YIF (0-End)
    Domains in SCOPe 2.07: d5yifa1, d5yifa2
  • Chain 'B':
    Compound: Pyruvylated beta-D-galactosidase
    Species: Bacillus sp. [TaxId:1409]
    Gene: ORF1119
    Database cross-references and differences (RAF-indexed):
    • PDB 5YIF (0-End)
    Domains in SCOPe 2.07: d5yifb1, d5yifb2
  • Heterogens: 8VR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yifA (A:)
    mkfphdflfgaasasyqvegawnedgkgvtnwdefskipgktyngtngdiavdhyhryke
    dvrlmaemglesyrfsiswarilptgdgkvnekgiefynnlideclkygivpfvtlyhwd
    lplplekdggwtnkrtaeafvkyaetcfkafgdrvkhwitfnatvmfcglgylkgahppg
    iqndvpkyfqathyvfyahaktvavykqlkqygeigithvflpaysvddqkeniqaanha
    neyetywyydpilkgeypsyvvqqlkekgwtpnwtveeleiikqnaeendfiglnyyqpi
    rverydmdikseehsrenstlapgnpsfdgfyrtvkmddktytkwgweispegfleglhm
    lkarygdikmyvtenglgdedpiidgeivdvprikfieahlkvmkraieeginlkgyyaw
    svidllswlngykkqygfifvdhndnlkrkkklsfhwykrvvetrgeelhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yifA (A:)
    mkfphdflfgaasasyqvegawnedgkgvtnwdefskipgktyngtngdiavdhyhryke
    dvrlmaemglesyrfsiswarilptgdgkvnekgiefynnlideclkygivpfvtlyhwd
    lplplekdggwtnkrtaeafvkyaetcfkafgdrvkhwitfnatvmfcglgylkgahppg
    iqndvpkyfqathyvfyahaktvavykqlkqygeigithvflpaysvddqkeniqaanha
    neyetywyydpilkgeypsyvvqqlkekgwtpnwtveeleiikqnaeendfiglnyyqpi
    rverydmdiklapgnpsfdgfyrtvkmddktytkwgweispegfleglhmlkarygdikm
    yvtenglgdedpiidgeivdvprikfieahlkvmkraieeginlkgyyawsvidllswln
    gykkqygfifvdhndnlkrkkklsfhwykrvvetrgeel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yifB (B:)
    mkfphdflfgaasasyqvegawnedgkgvtnwdefskipgktyngtngdiavdhyhryke
    dvrlmaemglesyrfsiswarilptgdgkvnekgiefynnlideclkygivpfvtlyhwd
    lplplekdggwtnkrtaeafvkyaetcfkafgdrvkhwitfnatvmfcglgylkgahppg
    iqndvpkyfqathyvfyahaktvavykqlkqygeigithvflpaysvddqkeniqaanha
    neyetywyydpilkgeypsyvvqqlkekgwtpnwtveeleiikqnaeendfiglnyyqpi
    rverydmdikseehsrenstlapgnpsfdgfyrtvkmddktytkwgweispegfleglhm
    lkarygdikmyvtenglgdedpiidgeivdvprikfieahlkvmkraieeginlkgyyaw
    svidllswlngykkqygfifvdhndnlkrkkklsfhwykrvvetrgeelhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yifB (B:)
    mkfphdflfgaasasyqvegawnedgkgvtnwdefskipgktyngtngdiavdhyhryke
    dvrlmaemglesyrfsiswarilptgdgkvnekgiefynnlideclkygivpfvtlyhwd
    lplplekdggwtnkrtaeafvkyaetcfkafgdrvkhwitfnatvmfcglgylkgahppg
    iqndvpkyfqathyvfyahaktvavykqlkqygeigithvflpaysvddqkeniqaanha
    neyetywyydpilkgeypsyvvqqlkekgwtpnwtveeleiikqnaeendfiglnyyqpi
    rverydmdiklapgnpsfdgfyrtvkmddktytkwgweispegfleglhmlkarygdikm
    yvtenglgdedpiidgeivdvprikfieahlkvmkraieeginlkgyyawsvidllswln
    gykkqygfifvdhndnlkrkkklsfhwykrvvetrgeel