PDB entry 5yhv

View 5yhv on RCSB PDB site
Description: Crystal structure of an aminotransferase from Mycobacterium tuberculosis
Class: transferase
Keywords: Aminotransferase, PLP-dependent, Amino acid metabolism, Cytoplasm, BIOSYNTHETIC PROTEIN, TRANSFERASE
Deposited on 2017-09-30, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: aspB, Rv3565
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96847 (6-393)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d5yhva1, d5yhva2
  • Chain 'B':
    Compound: aminotransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: aspB, Rv3565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yhvb_
  • Chain 'C':
    Compound: aminotransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: aspB, Rv3565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yhvc_
  • Chain 'D':
    Compound: aminotransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: aspB, Rv3565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yhvd_
  • Heterogens: GLU, GOL, PLP, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yhvA (A:)
    hhhhhhmtdrvalragvppfyvmdvwlaaaerqrthgdlvnlsagqpsagapepvraaaa
    aalhlnqlgysvalgipelrdaiaadyqrrhgitvepdavvittgssggfllaflacfda
    gdrvamaspgypcyrnilsalgcevveipcgpqtrfqptaqmlaeidpplrgvvvaspan
    ptgtvippeelaaiaswcdasdvrlisdevyhglvyqgapqtscawqtsrnavvvnsfsk
    yyamtgwrlgwllvptvlrravdcltgnfticppvlsqiaavsaftpeataeadgnlasy
    ainrsllldglrrigidrlaptdgafyvyadvsdftsdslafcsklladtgvaiapgidf
    dtarggsfvrisfagpsgdieealrrigswlpsq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yhvB (B:)
    hhhhhhmtdrvalragvppfyvmdvwlaaaerqrthgdlvnlsagqpsagapepvraaaa
    aalhlnqlgysvalgipelrdaiaadyqrrhgitvepdavvittgssggfllaflacfda
    gdrvamaspgypcyrnilsalgcevveipcgpqtrfqptaqmlaeidpplrgvvvaspan
    ptgtvippeelaaiaswcdasdvrlisdevyhglvyqgapqtscawqtsrnavvvnsfsk
    yyamtgwrlgwllvptvlrravdcltgnfticppvlsqiaavsaftpeataeadgnlasy
    ainrsllldglrrigidrlaptdgafyvyadvsdftsdslafcsklladtgvaiapgidf
    dtarggsfvrisfagpsgdieealrrigswlpsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yhvB (B:)
    tdrvalragvppfyvmdvwlaaaerqrthgdlvnlsagqpsagapepvraaaaaalhlnq
    lgysvalgipelrdaiaadyqrrhgitvepdavvittgssggfllaflacfdagdrvama
    spgypcyrnilsalgcevveipcgpqtrfqptaqmlaeidpplrgvvvaspanptgtvip
    peelaaiaswcdasdvrlisdevyhglvyqgapqtscawqtsrnavvvnsfskyyamtgw
    rlgwllvptvlrravdcltgnfticppvlsqiaavsaftpeataeadgnlasyainrsll
    ldglrrigidrlaptdgafyvyadvsdftsdslafcsklladtgvaiapgidfdtarggs
    fvrisfagpsgdieealrrigswlpsq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yhvC (C:)
    hhhhhhmtdrvalragvppfyvmdvwlaaaerqrthgdlvnlsagqpsagapepvraaaa
    aalhlnqlgysvalgipelrdaiaadyqrrhgitvepdavvittgssggfllaflacfda
    gdrvamaspgypcyrnilsalgcevveipcgpqtrfqptaqmlaeidpplrgvvvaspan
    ptgtvippeelaaiaswcdasdvrlisdevyhglvyqgapqtscawqtsrnavvvnsfsk
    yyamtgwrlgwllvptvlrravdcltgnfticppvlsqiaavsaftpeataeadgnlasy
    ainrsllldglrrigidrlaptdgafyvyadvsdftsdslafcsklladtgvaiapgidf
    dtarggsfvrisfagpsgdieealrrigswlpsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yhvC (C:)
    drvalragvppfmdvwlaaaerqrthgdlvnlsagqpsagapepvraaaaaalhlnqlgy
    svalgipelrdaiaadyqrrhgitvepdavvittgssggfllaflacfdagdrvamaspg
    ypcyrnilsalgcevveipcgpqtrfqptaqmlaeidpplrgvvvaspanptgtvippee
    laaiaswcdasdvrlisdevyhglvyqgapqtscawqtsrnavvvnsfskyyamtgwrlg
    wllvptvlrravdcltgnfticppvlsqiaavsaftpeataeadgnlasyainrsllldg
    lrrigidrlaptdgafyvyadvsdftsdslafcsklladtgvaiapgidfdtarggsfvr
    isfagpsgdieealrrigswlpsq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yhvD (D:)
    hhhhhhmtdrvalragvppfyvmdvwlaaaerqrthgdlvnlsagqpsagapepvraaaa
    aalhlnqlgysvalgipelrdaiaadyqrrhgitvepdavvittgssggfllaflacfda
    gdrvamaspgypcyrnilsalgcevveipcgpqtrfqptaqmlaeidpplrgvvvaspan
    ptgtvippeelaaiaswcdasdvrlisdevyhglvyqgapqtscawqtsrnavvvnsfsk
    yyamtgwrlgwllvptvlrravdcltgnfticppvlsqiaavsaftpeataeadgnlasy
    ainrsllldglrrigidrlaptdgafyvyadvsdftsdslafcsklladtgvaiapgidf
    dtarggsfvrisfagpsgdieealrrigswlpsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yhvD (D:)
    drvalragvppfmdvwlaaaerqgdlvnlsagqpsagapepvraaaaaalhlnqlgysva
    lgipelrdaiaadyqrrhgitvepdavvittgssggfllaflacfdagdrvamaspgypc
    yrnilsalgcevveipcgpqtrfqptaqmlaeidplrgvvvaspanptgtvippeelaai
    aswcdasdvrlisdevyhglvyqgapqtscawqtsrnavvvnsfskyyamtgwrlgwllv
    ptvlrravdcltgnfticppvlsqiaavsaftpeataeadgnlasyainrsllldglrri
    drlaptdafyvydvsdftslafcsklladtgvaiapgidfdtarggfvrisfagpsgdie
    ealr